Summary
Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife.
Theonlytimeshefeltalivewaswhenadrenalinecoursedthoroughhisveins.Hequicklyfoundthatextremesports,bungyjumping,cavediving&skydiving,gavehimthebiggestkicks.Thebiggertheadrenalinekick,thecloserhewastodeath,themorealivehefelt.
Wakingupinapileofdeadbodiesinanunknownland,afteradivingadventurehadendeddisastrously,hequicklyrealizesthebodyhenowpossessedwasnothisown.
FollowShiYanasheexploresthisnewworldwheredangerlurksaroundeverycorner,anddeathisonlyabreathaway;aworldinwhichShiYancouldnotfeelanymorealive.
You May Also Like
Novel Chapters 1618
- Chapter 1618 - Eternal immortal (Finished) Jun 30, 2026
- Chapter 1617 - Endless sorrow Jun 30, 2026
- Chapter 1616 - Blood fusion Jun 30, 2026
- Chapter 1615 - Awakening Jun 30, 2026
- Chapter 1614 - Power of natural law and order Jun 30, 2026
- Chapter 1613 - Origin of life Jun 30, 2026
- Chapter 1612 - Absolute Beginning’s Soul Consciousness Jun 30, 2026
- Chapter 1611 - Desolate’s Greatest Extreme Ancient Extinguis Jun 30, 2026
- Chapter 1610 - Insufficient Jun 30, 2026
- Chapter 1609 - Space’s broken! Shi Yan gets out! Jun 30, 2026
- Chapter 1608 - Shake the entire world! Jun 30, 2026
- Chapter 1607 - Meet up Jun 30, 2026
- Chapter 1606 - Swallow Devour! Jun 30, 2026
- Chapter 1605 - Achieving supreme enlightenment Jun 30, 2026
- Chapter 1604 - Falsify destiny! Jun 30, 2026
- Chapter 1603 - Swallow each other Jun 30, 2026
- Chapter 1602 - Evil clone! Jun 30, 2026
- Chapter 1601 - Survival of the fittest Jun 30, 2026
- Chapter 1600 - Racing against time! Jun 30, 2026
- Chapter 1599 - The originator of all evils Jun 30, 2026
- Chapter 1598 - Divine weapon! Jun 30, 2026
- Chapter 1597 - Swallow everything! Jun 30, 2026
- Chapter 1596 - One idea to give birth to the world Jun 30, 2026
- Chapter 1595 - Heaven never bars your way! Jun 30, 2026
- Chapter 1594 - The road of fusion Jun 30, 2026
- Chapter 1593 - Clones gather Jun 30, 2026
- Chapter 1592 - The battle on the glacier Jun 30, 2026
- Chapter 1591 - Searching Jun 30, 2026
- Chapter 1590 - The so-called opportunity Jun 30, 2026
- Chapter 1589 - Principle of Power Upanishads Jun 30, 2026
- Chapter 1588 - Open the Gate Jun 30, 2026
- Chapter 1587 - Arrive at the abyss Jun 30, 2026
- Chapter 1586 - Ten thousand bodies Jun 30, 2026
- Chapter 1585 - Sauronâs invitation Jun 30, 2026
- Chapter 1584 - Increase sharply! Jun 30, 2026
- Chapter 1583 - Shi Yan mends the sky! Jun 30, 2026
- Chapter 1582 - The Territory Shatters! Jun 30, 2026
- Chapter 1581 - The Consciousness Arrives! Jun 30, 2026
- Chapter 1580 - Soul attack! Jun 30, 2026
- Chapter 1579 Smelting Jun 30, 2026
- Chapter 1578 - Head to the Holy Land Jun 30, 2026
- Chapter 1577 - Prevailing trend Jun 30, 2026
- Chapter 1576 - Establish the world Jun 30, 2026
- Chapter 1575 - Endless Abyss Jun 30, 2026
- Chapter 1574 - Ensure the victory Jun 30, 2026
- Chapter 1573 - Create a Miracle! Jun 30, 2026
- Chapter 1572 - Eternal Seal! Jun 30, 2026
- Chapter 1571 - Brutal Battlefield Jun 30, 2026
- Chapter 1570 - Riot the Sea of Stars Jun 30, 2026
- Chapter 1569 - Vie for the Territory Souls! Jun 30, 2026
- Chapter 1568 - The Gate of Plundering Jun 30, 2026
- Chapter 1567 - Raid Huanglong directly! Jun 30, 2026
- Chapter 1566 - Reverse! Jun 30, 2026
- Chapter 1565 - Use one to resist ten thousand! Jun 30, 2026
- Chapter 1564 - Disseminate God power Jun 30, 2026
- Chapter 1563 - Is it doomsday? Jun 30, 2026
- Chapter 1562 - Shoulder great responsibilities! Jun 30, 2026
- Chapter 1561 - Invincible! Invincible! Jun 30, 2026
- Chapter 1560 - The Second Sky of Territory Ancestor Realm! Jun 30, 2026
- Chapter 1559 - Dogfight Jun 30, 2026
- Chapter 1558 - Rampage to Break the Challenge! Jun 30, 2026
- Chapter 1557 - Desperate Straits! Jun 30, 2026
- Chapter 1556 - Drink Blood and Eat Flesh Jun 30, 2026
- Chapter 1555 - Ambush Jun 30, 2026
- Chapter 1554 - Zhen Ru Jun 30, 2026
- Chapter 1553 - The Great Race War Jun 30, 2026
- Chapter 1552 - The Title of God of Slaughter! Jun 30, 2026
- Chapter 1551 - Sweep Away Many Clans Jun 30, 2026
- Chapter 1550 - A New Original Symbol! Jun 30, 2026
- Chapter 1549 - Muster a Large Force Jun 30, 2026
- Chapter 1548 - Great Shock Jun 30, 2026
- Chapter 1547 - Court Death Jun 30, 2026
- Chapter 1546 - Fire Bathing Phoenix Jun 30, 2026
- Chapter 1545 - Absolute Beginning! Jun 30, 2026
- Chapter 1544 - Dispel Doubts Jun 30, 2026
- Chapter 1543 - The Agreement in the Past Jun 30, 2026
- Chapter 1542 - Disclose Feelings Jun 30, 2026
- Chapter 1541 - Zi Yao is Born Again! Jun 30, 2026
- Chapter 1540 - Fearfully Barbarian Jun 30, 2026
- Chapter 1539 - Borrow Power! Jun 30, 2026
- Chapter 1538 - Savage Yuan Jun 30, 2026
- Chapter 1537 - Flawless Calculation Jun 30, 2026
- Chapter 1536 - Turning Hostile Jun 30, 2026
- Chapter 1535 - Get Zi Yao Back! Jun 30, 2026
- Chapter 1534 - Move the Mountains and Overthrow the Seas Jun 30, 2026
- Chapter 1533 - Restlessly Impatient Jun 30, 2026
- Chapter 1532 - Tranquil Mind Jun 30, 2026
- Chapter 1531 - Yuan Zu Jun 30, 2026
- Chapter 1530 - Pure Gold Spirit Ant Jun 30, 2026
- Chapter 1529 - Dreadful Might Fills the Sky! Jun 30, 2026
- Chapter 1528 - Trample! Jun 30, 2026
- Chapter 1527 - Retaliation Starts From You! Jun 30, 2026
- Chapter 1526 - Surpass Bloodthirsty! Jun 30, 2026
- Chapter 1525 - The World-destroying Might Jun 30, 2026
- Chapter 1524 - Fierce Jun 30, 2026
- Chapter 1523 - Territory Ancestor Jun 30, 2026
- Chapter 1522 - Permeating Jun 30, 2026
- Chapter 1521 - The Natural Space Wall Jun 30, 2026
- Chapter 1520 - Beseech Battle! Jun 30, 2026
- Chapter 1519 - Troublesome Jun 30, 2026
- Chapter 1518 - Skyfall Star River Absolute Beginning Divine Jun 30, 2026
- Chapter 1517 - Cloud Mist Territory Jun 30, 2026
- Chapter 1516 - Sauron Jun 30, 2026
- Chapter 1515 - Great Seal! Jun 30, 2026
- Chapter 1514 - Do Not Return Jun 30, 2026
- Chapter 1513 - A Random Encounter Jun 30, 2026
- Chapter 1512 - To the Heart’s Content, Staying at Present! Jun 30, 2026
- Chapter 1511 - The Original Symbol Embryo Jun 30, 2026
- Chapter 1510 - Leave No One Alive! Jun 30, 2026
- Chapter 1509 - Discharge Resentment! Jun 30, 2026
- Chapter 1508 - The Light in the Desperate Straits Jun 30, 2026
- Chapter 1507 - Anger Against a Common Enemy Jun 30, 2026
- Chapter 1506 - Drifting Far Away Jun 30, 2026
- Chapter 1505 - Bloodthirsty’s Last Words Jun 30, 2026
- Chapter 1504 - The Path Ahead Jun 30, 2026
- Chapter 1503 - Great Seal Technique Jun 30, 2026
- Chapter 1502 - Time has changed Jun 30, 2026
- Chapter 1501 - The Absolute Beginning Gateway Jun 30, 2026
- Chapter 1500 - Thing returns to its rightful owner Jun 30, 2026
- Chapter 1499 - Walk on the road of fusion! Jun 30, 2026
- Chapter 1498 - Foresight Jun 30, 2026
- Chapter 1497 - Wipe out the entire world! Jun 30, 2026
- Chapter 1496 - The Ark! Jun 30, 2026
- Chapter 1495 - The day the star area ends! Jun 30, 2026
- Chapter 1494 - The true body arrives! Jun 30, 2026
- Chapter 1493 - I saw that I died! Jun 30, 2026
- Chapter 1492 Jun 30, 2026
- Chapter 1491 - Are you her? Jun 30, 2026
- Chapter 1490 - Alarm! Jun 30, 2026
- Chapter 1489 - Third Sky of Immortal Realm! Jun 30, 2026
- Chapter 1488 - Swallow! Jun 30, 2026
- Chapter 1487 - The reversed flow of time! Jun 30, 2026
- Chapter 1486 - Strength of the Territory Master Jun 30, 2026
- Chapter 1485 - You’re not qualified! Jun 30, 2026
- Chapter 1484 - The battle that lasts ten thousand years Jun 30, 2026
- Chapter 1483 - Predestined enemy! Jun 30, 2026
- Chapter 1482 - Reach an agreement Jun 30, 2026
- Chapter 1481 - Gather by the territory entrance Jun 30, 2026
- Chapter 1480 - Ignite Jun 30, 2026
- Chapter 1479 - Link up the territories Jun 30, 2026
- Chapter 1478 - The Dark Abyss Jun 30, 2026
- Chapter 1477 - Goddess Mother Jun 30, 2026
- Chapter 1476 - New structure Jun 30, 2026
- Chapter 1475 - Return! Jun 30, 2026
- Chapter 1474 Jun 30, 2026
- Chapter 1473 - Apprehend the Creation Jun 30, 2026
- Chapter 1472 - Awaken One By One Jun 30, 2026
- Chapter 1471 - Desolate Territory’s Outer Layer Jun 30, 2026
- Chapter 1470 - Shaking Fallout Jun 30, 2026
- Chapter 1469 - Sky and Earth Turning Upside Down! Jun 30, 2026
- Chapter 1468 - Yin and Yang - Left and Right Jun 30, 2026
- Chapter 1467 - Constellation Power! Jun 30, 2026
- Chapter 1466 - Are You Still Sleepy? Jun 30, 2026
- Chapter 1465 - Wage War Everywhere! Jun 30, 2026
- Chapter 1464 - Return! Jun 30, 2026
- Chapter 1463 - Exposed One By One Jun 30, 2026
- Chapter 1462 - Free Fight! Jun 30, 2026
- Chapter 1461 - Lord of All Stars! Jun 30, 2026
- Chapter 1460 - All Dreadful Devils Come! Jun 30, 2026
- Chapter 1459 - One Gets Through, All Gets Through! Jun 30, 2026
- Chapter 1458 - Clash of Territories! Jun 30, 2026
- Chapter 1457 - Enlightened by the Broken Star Jun 30, 2026
- Chapter 1456 - It’s the Will of Heaven Jun 30, 2026
- Chapter 1455 - Fierce Outbreak! Jun 30, 2026
- Chapter 1454 - Bloodshed on the Seabed Jun 30, 2026
- Chapter 1453 - The Space Cross Slash Jun 30, 2026
- Chapter 1452 - Emperor Sea Shark Jun 30, 2026
- Chapter 1451 - Hiro! Jun 30, 2026
- Chapter 1450 - Deny Flatly Jun 30, 2026
- Chapter 1449 - Run Into Jun 30, 2026
- Chapter 1448 - Capture Jun 30, 2026
- Chapter 1447 - Disguise and Sneak Jun 30, 2026
- Chapter 1446 - Massacre the Entire Island Jun 30, 2026
- Chapter 1445 - Be an Obedient Woman Jun 30, 2026
- Chapter 1444 - Mei Ji’s Harvest Jun 30, 2026
- Chapter 1443 - Mistakenly Hit! Jun 30, 2026
- Chapter 1442 - Bewitch Jun 30, 2026
- Chapter 1441 - Part and Take Action! Jun 30, 2026
- Chapter 1440 - Wantonly Massacre! Jun 30, 2026
- Chapter 1439 - The Entire Sea of Annihilation is Surging! Jun 30, 2026
- Chapter 1438 - Mei Ji’s Boldness! Jun 30, 2026
- Chapter 1437 - Frantic Suppression! Jun 30, 2026
- Chapter 1436 - A Strong Current Jun 30, 2026
- Chapter 1435 - Enjoy a Carefree Meal! Jun 30, 2026
- Chapter 1434 - Invincible Might from the Sky! Jun 30, 2026
- Chapter 1433 - Surging Vitality! Jun 30, 2026
- Chapter 1432 - Collect! Jun 30, 2026
- Chapter 1431 - You Are Still Unskilled! Jun 30, 2026
- Chapter 1430 - Among What is True and What is False Jun 30, 2026
- Chapter 1429 - Must Vie For it! Jun 30, 2026
- Chapter 1428 - Rise the Might in the Foreign Land Jun 30, 2026
- Chapter 1427 - The Ultimate Power Upanishad! Jun 30, 2026
- Chapter 1426 - The Absolute Beginning Original Symbol! Jun 30, 2026
- Chapter 1425 - It is… Life! Jun 30, 2026
- Chapter 1424 - I Don’t Dare to Make That Step Jun 30, 2026
- Chapter 1423 - Meet Old Friends Jun 30, 2026
- Chapter 1422 - Penetrate! Jun 30, 2026
- Chapter 1421 - The Ruins Under the Sea Jun 30, 2026
- Chapter 1420 - She’s My Woman! Jun 30, 2026
- Chapter 1419 - Sly Change! Jun 30, 2026
- Chapter 1418 - Cannon Fodder? Jun 30, 2026
- Chapter 1417 - Go Together Jun 30, 2026
- Chapter 1416 - The Call from the Seabed Jun 30, 2026
- Chapter 1415 - Also a Pitiful Woman Jun 30, 2026
- Chapter 1414 - Separate Jun 30, 2026
- Chapter 1413 - Waiting for a Man Jun 30, 2026
- Chapter 1412 - The Sea of Annihilation Jun 30, 2026
- Chapter 1411 - Shadow Jun 30, 2026
- Chapter 1410 - Power Upanishad Superiority Jun 30, 2026
- Chapter 1409 - Bully the Beauty Jun 30, 2026
- Chapter 1408 - Counterattack! Jun 30, 2026
- Chapter 1407 - Join Hands Jun 30, 2026
- Chapter 1406 - Detoxify! Jun 30, 2026
- Chapter 1405 - Mysterious Yin Corpse Worm Jun 30, 2026
- Chapter 1404 - The Real Origin of the Soul Inside the Ring Jun 30, 2026
- Chapter 1403 - Parents’ Love Jun 30, 2026
- Chapter 1402 - A Turn for the Better! Jun 30, 2026
- Chapter 1401 - A Little Skeleton Jun 30, 2026
- Chapter 1400 - Skull Island Jun 30, 2026
- Chapter 1399 - Fortune Jun 30, 2026
- Chapter 1398 - Soul as the Sea Jun 30, 2026
- Chapter 1397 - Turn the Situation Around! Jun 30, 2026
- Chapter 1396 - World Within World Jun 30, 2026
- Chapter 1395 - A Matter of Life or Death Jun 30, 2026
- Chapter 1394 - Dragon Lizard’s True Body Jun 30, 2026
- Chapter 1393 - Goddess’ Gorgeous Dance Jun 30, 2026
- Chapter 1392 - Conceal Jun 30, 2026
- Chapter 1391 - Lord of All Skies Jun 30, 2026
- Chapter 1390 - Instigate Jun 30, 2026
- Chapter 1389 - Immortal Realm! Jun 30, 2026
- Chapter 1388 - Conflict Jun 30, 2026
- Chapter 1387 - Festival Jun 30, 2026
- Chapter 1386 - Cut the Flesh Jun 30, 2026
- Chapter 1385 - Break the Bottleneck Jun 30, 2026
- Chapter 1384 - Reward Jun 30, 2026
- Chapter 1383 - Soul Refining Cauldron Jun 30, 2026
- Chapter 1382 - Twisting and Turning Jun 30, 2026
- Chapter 1381 - You Think You Can Run Away? Jun 30, 2026
- Chapter 1380 - Lead the Wolf Into the House Jun 30, 2026
- Chapter 1379 - Ten Great Territory Ancestors Jun 30, 2026
- Chapter 1378 - The Fascinating Divine Eye Jun 30, 2026
- Chapter 1377 - Lost Jun 30, 2026
- Chapter 1376 - Reflected Glory Jun 30, 2026
- Chapter 1375 - Boldness of Vision Jun 30, 2026
- Chapter 1374 Jun 30, 2026
- Chapter 1373 - Unlock the Spatial Lock Jun 30, 2026
- Chapter 1372 - Fantasy Boundary Stone Jun 30, 2026
- Chapter 1371 - Trade for Items Jun 30, 2026
- Chapter 1370 - Forefather Dragon Lizard Jun 30, 2026
- Chapter 1369 - Immortal Pellet Jun 30, 2026
- Chapter 1368 - The Seven Great Races Jun 30, 2026
- Chapter 1367 - Ming Hong Jun 30, 2026
- Chapter 1366 - A Derelict Item Jun 30, 2026
- Chapter 1365 - An Absolute Beginning weapon? Jun 30, 2026
- Chapter 1364 - Dragon Lizard Clan Jun 30, 2026
- Chapter 1363 - A Bad Hand Destroys the Flower Jun 30, 2026
- Chapter 1362 - Lord of Stars! Jun 30, 2026
- Chapter 1361 - The First Battle in the Sea Domain! Jun 30, 2026
- Chapter 1360 - Three Kinds of Living Beings Jun 30, 2026
- Chapter 1359 - Heavenly Eye Clan Jun 30, 2026
- Chapter 1358 - The Absolute Beginning Symbols Jun 30, 2026
- Chapter 1357 - A Three-legged Jade Cauldron Jun 30, 2026
- Chapter 1356 - Using Blood to Create the Body Jun 30, 2026
- Chapter 1355 - The Asteroid Current Jun 30, 2026
- Chapter 1354 - The Long, Lonesome Days Jun 30, 2026
- Chapter 1353 - The Sea Domain of Nihility Jun 30, 2026
- Chapter 1352 - Causes and Effects Jun 30, 2026
- Chapter 1351 - A Bloody Battle Jun 30, 2026
- Chapter 1350 - The Twelve-headed Serpent Jun 30, 2026
- Chapter 1349 - Mistress Jun 30, 2026
- Chapter 1348 - That power! Jun 30, 2026
- Chapter 1347 - The Life Magnetic Field Rockets! Jun 30, 2026
- Chapter 1346 - Hui Counterattacks! Jun 30, 2026
- Chapter 1345 - New power! Jun 30, 2026
- Chapter 1344 - Soul Congregating Jun 30, 2026
- Chapter 1343 - God Lord Jun 30, 2026
- Chapter 1342 - Hui (*) Jun 30, 2026
- Chapter 1341 - Transform! Jun 30, 2026
- Chapter 1340 Jun 30, 2026
- Chapter 1339 - Good Fortune Fills Up to the Sky Jun 30, 2026
- Chapter 1338 - Frantic Bursting! Jun 30, 2026
- Chapter 1337 - Doomsday is Coming! Jun 30, 2026
- Chapter 1336 - The Unsolved Riddle Jun 30, 2026
- Chapter 1335 - Living in the Sheep Pasture Jun 30, 2026
- Chapter 1334 Jun 30, 2026
- Chapter 1333: Gigantic Worm Jun 30, 2026
- Chapter 1332: Refine Jun 30, 2026
- Chapter 1331: The Big Meatball Jun 30, 2026
- Chapter 1330: The Anonymous Evil Thing Jun 30, 2026
- Chapter 1329: Sly Land Jun 30, 2026
- Chapter 1328: Walking Free Jun 30, 2026
- Chapter 1327: Outer Space Divine Light Jun 30, 2026
- Chapter 1326: Warm Their Hearts Jun 30, 2026
- Chapter 1325: He’s My Man Jun 30, 2026
- Chapter 1324: Lead the Evil Around Jun 30, 2026
- Chapter 1323: Set Up Earth and Heaven Jun 30, 2026
- Chapter 1322: Collapsed and Destroyed! Jun 30, 2026
- Chapter 1321: Unrivalled Great Devil! Jun 30, 2026
- Chapter 1320: Death and Life Rotating Bridge Jun 30, 2026
- Chapter 1319: Erode the Entire World Jun 30, 2026
- Chapter 1318: Crazily Spread Out! Jun 30, 2026
- Chapter 1317: Wederson Rampages! Shi Yan is About to Explode Jun 30, 2026
- Chapter 1316: Deadly Field Jun 30, 2026
- Chapter 1315: Tough Encounter! Jun 30, 2026
- Chapter 1314: Bite and Nibble! Jun 30, 2026
- Chapter 1313: Come to the Frontline With Me! Jun 30, 2026
- Chapter 1312: The Master Arrives Jun 30, 2026
- Chapter 1311: General Situation Jun 30, 2026
- Chapter 1310: The Same Gateway Jun 30, 2026
- Chapter 1309: A Showdown of Immortal Realm Experts! Jun 30, 2026
- Chapter 1308: Old Friends Reunite Jun 30, 2026
- Chapter 1307: Lei Di and Qing Xiao (Bright Lightning and Azu Jun 30, 2026
- Chapter 1306: Ignite the Flame of Life! Jun 30, 2026
- Chapter 1305: Thunder Dragon’s Skeleton Jun 30, 2026
- Chapter 1304: Human Nature Jun 30, 2026
- Chapter 1303: Candid Counterpart Jun 30, 2026
- Chapter 1302: A New Life! Jun 30, 2026
- Chapter 1301: Self-Freezing Jun 30, 2026
- Chapter 1300: Gambling Jun 30, 2026
- Chapter 1299: One is Enough Jun 30, 2026
- Chapter 1298: One vs. Two Jun 30, 2026
- Chapter 1297: Rush to the Tiger’s Den Jun 30, 2026
- Chapter 1296: Human Head Feast Jun 30, 2026
- Chapter 1295: A Blood Reeking Journey Jun 30, 2026
- Chapter 1294: Risk Life! Jun 30, 2026
- Chapter 1293: Slaughter Jun 30, 2026
- Chapter 1292: The Chen family Jun 30, 2026
- Chapter 1291: DeCarlos Jun 30, 2026
- Chapter 1290: Life Sublimation Jun 30, 2026
- Chapter 1289: Unyielding Jun 30, 2026
- Chapter 1288: Carefree Jun 30, 2026
- Chapter 1287: Clearly See the Crisis Jun 30, 2026
- Chapter 1286: Profound Comprehension Jun 30, 2026
- Chapter 1285: An Ambiguous Relationship Jun 30, 2026
- Chapter 1284: Who is He After All? Jun 30, 2026
- Chapter 1283: My Woman! Jun 30, 2026
- Chapter 1282: Overbearing Jun 30, 2026
- Chapter 1281: Posturing? Jun 30, 2026
- Chapter 1280: Guard the Tree Stump and Wait for the Rabbit Jun 30, 2026
- Chapter 1279: Primordial Spirit Lock Jun 30, 2026
- Chapter 1278: Teasing Jun 30, 2026
- Chapter 1277: You are not Qualified! Jun 30, 2026
- Chapter 1276: Open the Space Jun 30, 2026
- Chapter 1275: Fantasy Zone Jun 30, 2026
- Chapter 1274: Heavenly King Light Jun 30, 2026
- Chapter 1273: An Earth-shaking Conjecture Jun 30, 2026
- Chapter 1272: Seal Jun 30, 2026
- Chapter 1271: The Ring Spirit Jun 30, 2026
- Chapter 1270: You’re Not It! Jun 30, 2026
- Chapter 1269: Sudden Change Jun 30, 2026
- Chapter 1268: Compete for the Chief Position Jun 30, 2026
- Chapter 1267: Empower Jun 30, 2026
- Chapter 1266: The Three Great Chiefs Jun 30, 2026
- Chapter 1265: There’s an Energy Jun 30, 2026
- Chapter 1264: The Bloodthirsty’s Statue Jun 30, 2026
- Chapter 1263: Frantic Jun 30, 2026
- Chapter 1262: Step into the Blood Sea Jun 30, 2026
- Chapter 1261: Commit Jun 30, 2026
- Chapter 1260: My World! Jun 30, 2026
- Chapter 1259: The Heavenly Monster Tribe’s Perfect Plan Jun 30, 2026
- Chapter 1258: I’m the Master! Jun 30, 2026
- Chapter 1257: Reunite Jun 30, 2026
- Chapter 1256: The Blood Imperial Order Jun 30, 2026
- Chapter 1255: The Cortege of Eight Jun 30, 2026
- Chapter 1254: Senro – Chief of Despair Force Jun 30, 2026
- Chapter 1253: The Ring Spirit’s Fixation Jun 30, 2026
- Chapter 1252: Blood Sea, Bone Islands Jun 30, 2026
- Chapter 1251: Struggle to Escape! Jun 30, 2026
- Chapter 1250: Internal Strife? Jun 30, 2026
- Chapter 1249: A Coffin Jun 30, 2026
- Chapter 1248: Compete for a Seat Jun 30, 2026
- Chapter 1247: Go to the Next Level Jun 30, 2026
- Chapter 1246: God Lord’s Soul Arrives Jun 30, 2026
- Chapter 1245: Frederick Jun 30, 2026
- Chapter 1244: Devouring! Jun 30, 2026
- Chapter 1243: Fusing power Upanishads! Jun 30, 2026
- Chapter 1242: Outstanding Heroes Stir Up! Jun 30, 2026
- Chapter 1241: Meticulous Arrangement Jun 30, 2026
- Chapter 1240: Puzzled Jun 30, 2026
- Chapter 1239: One Finger Jun 30, 2026
- Chapter 1238: Bloodthirsty’s Aura Jun 30, 2026
- Chapter 1237: A Small Jade Box Jun 30, 2026
- Chapter 1236: Black Iron City Jun 30, 2026
- Chapter 1235: The Tsunami Chamber of Commerce Jun 30, 2026
- Chapter 1234: Fulfill the Promise Jun 30, 2026
- Chapter 1233: Unyielding Jun 30, 2026
- Chapter 1232: Immortal Jun 30, 2026
- Chapter 1231: Mega Work! Jun 30, 2026
- Chapter 1230: Fame Jun 30, 2026
- Chapter 1229: Return with a Whole Life Star! Jun 30, 2026
- Chapter 1228: Chaos Appears Jun 30, 2026
- Chapter 1227: Create the Miracle! Jun 30, 2026
- Chapter 1226: The Monster Ancestor’s Blood Sacrifice! Jun 30, 2026
- Chapter 1225: The Azure Dragon Wakes Up Jun 30, 2026
- Chapter 1224: Just Like That Year Jun 30, 2026
- Chapter 1223: Great Victory! Jun 30, 2026
- Chapter 1222: End of the Legend Jun 30, 2026
- Chapter 1221: Bloody Fight Jun 30, 2026
- Chapter 1220: Don’t Wanna Be a Dog Anymore! Jun 30, 2026
- Chapter 1219: Who’s Your Teacher? Jun 30, 2026
- Chapter 1218: The Second Strong Hit! Jun 30, 2026
- Chapter 1217: The God Punishment’s Reduced Power Jun 30, 2026
- Chapter 1216: The God Clan’s Great Slayer! Jun 30, 2026
- Chapter 1215: God Clan Requests Reinforcements Jun 30, 2026
- Chapter 1214: Mutant Bloodline Jun 30, 2026
- Chapter 1213: Clever Jun 30, 2026
- Chapter 1212: Burn the Soul Jun 30, 2026
- Chapter 1211: Great Boost For the Morale! Jun 30, 2026
- Chapter 1210: Well Fortified Jun 30, 2026
- Chapter 1209: Respect Jun 30, 2026
- Chapter 1208: Snatch Money! Jun 30, 2026
- Chapter 1207: Shake the Entire Sea of Stars! Jun 30, 2026
- Chapter 1206: Blood Devil’s Breakthrough Jun 30, 2026
- Chapter 1205: March to the Front! Jun 30, 2026
- Chapter 1204: It’s Good... that You Can Come Back! Jun 30, 2026
- Chapter 1203: The Style of That Slash! Jun 30, 2026
- Chapter 1202: Shi Yan Draws a Circle by the Blood Pond Jun 30, 2026
- Chapter 1201: The Boiling Blood Pond Jun 30, 2026
- Chapter 1200: The King is Back! Jun 30, 2026
- Chapter 1199: Experts Get Together Jun 30, 2026
- Chapter 1198: There’s a Force Jun 30, 2026
- Chapter 1197: Scheme Against the World! Jun 30, 2026
- Chapter 1196: World Famous Jun 30, 2026
- Chapter 1195: Sea Territory Jun 30, 2026
- Chapter 1194: Return Jun 30, 2026
- Chapter 1193: Awaken! Jun 30, 2026
- Chapter 1192: The One Who has Disappeared for Ten Years Jun 30, 2026
- Chapter 1191: The Structure of the World Jun 30, 2026
- Chapter 1190: The World Purifying Light! Jun 30, 2026
- Chapter 1189: The Burning Karma Flame Jun 30, 2026
- Chapter 1188: The Collision of the Two Worlds! Jun 30, 2026
- Chapter 1187: Sly Change! Jun 30, 2026
- Chapter 1186: Blood Sword Breaking Divine Boat Jun 30, 2026
- Chapter 1185: Replace the World! Jun 30, 2026
- Chapter 1184: The Cold Eye of a Bystander Jun 30, 2026
- Chapter 1183: I’m Helping You Jun 30, 2026
- Chapter 1182: Crazy Harson! Jun 30, 2026
- Chapter 1181: The World Tree Jun 30, 2026
- Chapter 1180: The Genesis Fruit Jun 30, 2026
- Chapter 1179: Destination Jun 30, 2026
- Chapter 1178: The Third Sky of Ethereal God Realm Jun 30, 2026
- Chapter 1177: It Seems Like a Dreamland Jun 30, 2026
- Chapter 1176: Wonderland Jun 30, 2026
- Chapter 1175: After Five Years! Jun 30, 2026
- Chapter 1174: The Remains of the Holy Beast White Tiger Jun 30, 2026
- Chapter 1173: Who You Used to be? Jun 30, 2026
- Chapter 1172: Harson’s Riddle Jun 30, 2026
- Chapter 1171: Resurrected? Jun 30, 2026
- Chapter 1170: Real Competence! Jun 30, 2026
- Chapter 1169: The Icy World Jun 30, 2026
- Chapter 1168: Show the Inferior Face to the Enemy Jun 30, 2026
- Chapter 1167: Healing! Jun 30, 2026
- Chapter 1166: Desolate’s Generous Gifts Jun 30, 2026
- Chapter 1165: Capture the Heart Jun 30, 2026
- Chapter 1164: A Separate-spatial Battle! Jun 30, 2026
- Chapter 1163: The Eight Great Chiefs Jun 30, 2026
- Chapter 1162: The Cradle of Mazes Jun 30, 2026
- Chapter 1161: Invest All the Affection Jun 30, 2026
- Chapter 1160: It’s Watching You Jun 30, 2026
- Chapter 1159: Refine the Ancient Continent? Jun 30, 2026
- Chapter 1158: Fusing Three Heaven Flames Jun 30, 2026
- Chapter 1157: Someone Lives, Someone Dies Jun 30, 2026
- Chapter 1156: Desolate Jun 30, 2026
- Chapter 1155: Cang Yun won’t Get the Worst of it Jun 30, 2026
- Chapter 1154: Burning Purgatory Jun 30, 2026
- Chapter 1153: The World of Five-colored Light Jun 30, 2026
- Chapter 1152: Frantic Showdown! Jun 30, 2026
- Chapter 1151: Immortal Body! Jun 30, 2026
- Chapter 1150: The Bloody Bone Has a New Owner Jun 30, 2026
- Chapter 1149: It’s the First One! Jun 30, 2026
- Chapter 1148: Seize Power! Jun 30, 2026
- Chapter 1147: Turn Earth and Heaven Around Jun 30, 2026
- Chapter 1146: Trust Jun 30, 2026
- Chapter 1145: White Bone Refining Blood Ghost Grave Jun 30, 2026
- Chapter 1144: The Charteris Family Jun 30, 2026
- Chapter 1143: A Samsara Jun 30, 2026
- Chapter 1142: Little Fatty Jun 30, 2026
- Chapter 1141: Refine the Ethereal Extent Jun 30, 2026
- Chapter 1140: The Scarlet Flaming Heart Jun 30, 2026
- Chapter 1139: Deadlock Jun 30, 2026
- Chapter 1138: Join Hands Jun 30, 2026
- Chapter 1137: Heavenly Monster Tribe and Imperial Dark Tribe Jun 30, 2026
- Chapter 1136: The Four Great Creatures Jun 30, 2026
- Chapter 1135: Cross the Border Jun 30, 2026
- Chapter 1134: Great Responsibility Jun 30, 2026
- Chapter 1133: Predestined Mortal Enemy Jun 30, 2026
- Chapter 1132: Who is the Backbone? Jun 30, 2026
- Chapter 1131: Achieve his Desire Jun 30, 2026
- Chapter 1130: Use the Old Trick Again Jun 30, 2026
- Chapter 1129: Instant Kill! Jun 30, 2026
- Chapter 1128: The Sudden Incident Jun 30, 2026
- Chapter 1127: Stealth Jun 30, 2026
- Chapter 1126: The Fearful Formation Under the Lake Jun 30, 2026
- Chapter 1125: Why Me All the Time? Jun 30, 2026
- Chapter 1124: Prepare the Ambush Jun 30, 2026
- Chapter 1123: Getting Serious! Jun 30, 2026
- Chapter 1122: The Servant Flower and the Master Flower Jun 30, 2026
- Chapter 1121: Prevail Jun 30, 2026
- Chapter 1120: Shed All Pretense of Cordiality! Jun 30, 2026
- Chapter 1119: A Move to Change All Jun 30, 2026
- Chapter 1118: What Does it Matter to Me? Jun 30, 2026
- Chapter 1117: Hold Hostage! Jun 30, 2026
- Chapter 1116: Break the Barrier! Jun 30, 2026
- Chapter 1115: Pressing Earth and Heaven’s Prestige Jun 30, 2026
- Chapter 1114: Needlepoint vs Spearhead Jun 30, 2026
- Chapter 1113: Hidden Dragon Tying Sky Jun 30, 2026
- Chapter 1112: Destroy Jun 30, 2026
- Chapter 1111: Unvalued Little Fish Jun 30, 2026
- Chapter 1110: Are you All Mistaken? Jun 30, 2026
- Chapter 1109: Is He Really Strong? Jun 30, 2026
- Chapter 1108: The Five Great Territories Jun 30, 2026
- Chapter 1107: Refine the Fruit Tree Jun 30, 2026
- Chapter 1106: Change Again and Again Jun 30, 2026
- Chapter 1105: Awkward Exposition Jun 30, 2026
- Chapter 1104: The Brilliant Star Fruit Tree Jun 30, 2026
- Chapter 1103: Upset a Plan Jun 30, 2026
- Chapter 1102: The General Situation of the Sea of Stars Jun 30, 2026
- Chapter 1101: Hand in Hand Jun 30, 2026
- Chapter 1100: Break the Shackles Jun 30, 2026
- Chapter 1099: Soul Kalpa Jun 30, 2026
- Chapter 1098: Forcefully Seize Jun 30, 2026
- Chapter 1097: Panic and Upheaval! Jun 30, 2026
- Chapter 1096: A Sudden Fatal Attack! Jun 30, 2026
- Chapter 1095: Do You Have Some More? Jun 30, 2026
- Chapter 1094: The Gu God Sect (*) Jun 30, 2026
- Chapter 1093: Hundred Kalpa Ghost Hand Rattan Jun 30, 2026
- Chapter 1092: Refine Blood Jun 30, 2026
- Chapter 1091: Ancient Continent Jun 30, 2026
- Chapter 1090: Outstanding Talents Jun 30, 2026
- Chapter 1089: Desolate Jun 30, 2026
- Chapter 1088: Soul Rotting Aphids Jun 30, 2026
- Chapter 1087: Great Sage Jun 30, 2026
- Chapter 1086: The Fate Traveler Jun 30, 2026
- Chapter 1085: Soul Incantations Jun 30, 2026
- Chapter 1084: Gu He Jun 30, 2026
- Chapter 1083: Meditate and calm the soul Jun 30, 2026
- Chapter 1082: Talented Field Commander! Jun 30, 2026
- Chapter 1081: Link Up Jun 30, 2026
- Chapter 1080: Topple the beliefs Jun 30, 2026
- Chapter 1079: Better to fight once! Jun 30, 2026
- Chapter 1078: Pressure-resistant Jun 30, 2026
- Chapter 1077: Build the formation Jun 30, 2026
- Chapter 1076: Three flames unite Jun 30, 2026
- Chapter 1075: A competition of envy Jun 30, 2026
- Chapter 1074: The dream they once had Jun 30, 2026
- Chapter 1073: Old friends Jun 30, 2026
- Chapter 1072: Dissolve Jun 30, 2026
- Chapter 1071: Spreading Jun 30, 2026
- Chapter 1070: Dispel the Former Hatred Jun 30, 2026
- Chapter 1069: Poison-dipped Cold Bead Jun 30, 2026
- Chapter 1068: The Two Women Jun 30, 2026
- Chapter 1067: Holding Hostage Jun 30, 2026
- Chapter 1066: A Divine Crystal Mineral Lode Jun 30, 2026
- Chapter 1065: Divine Light Jun 30, 2026
- Chapter 1064: I’m Not Resigned to That! Jun 30, 2026
- Chapter 1063: Burn Your Hand, Feel the Heat Jun 30, 2026
- Chapter 1062: Really... I Didn’t do it Intentionally Jun 30, 2026
- Chapter 1061: I Say You Can Do it so You Can Do it! Jun 30, 2026
- Chapter 1060: Leona’s Spearhead! Jun 30, 2026
- Chapter 1059: Battling Jun 30, 2026
- Chapter 1058: Her Graceful Bearing Jun 30, 2026
- Chapter 1057: Meeting the Enemy Head-on Jun 30, 2026
- Chapter 1056: See the Sunlight Again Jun 30, 2026
- Chapter 1055: Refine the Sea Jun 30, 2026
- Chapter 1054: The Ones Who Cross the Border Jun 30, 2026
- Chapter 1053: Able to Break Any Unyielding Thing! Jun 30, 2026
- Chapter 1052: A Whole Entity Jun 30, 2026
- Chapter 1051: The Talkative Woman Jun 30, 2026
- Chapter 1050: Reverse in Just a Flash Jun 30, 2026
- Chapter 1049: The Fountainhead of Powers Upanishad Jun 30, 2026
- Chapter 1048: Departed Spirit Jellyfish Jun 30, 2026
- Chapter 1047: Poisonous Sea Jun 30, 2026
- Chapter 1046: Cutting space Jun 30, 2026
- Chapter 1045: The change of the co-soul Jun 30, 2026
- Chapter 1044: The remains of the Holy Beast Jun 30, 2026
- Chapter 1043: Shoulder the responsibility Jun 30, 2026
- Chapter 1042: Going Out Jun 30, 2026
- Chapter 1041: Ethereal Extent Jun 30, 2026
- Chapter 1040: Allied forces Jun 30, 2026
- Chapter 1039: Accumulating Energy Jun 30, 2026
- Chapter 1038: The Shadow Ghostly Prison is Boiling! Jun 30, 2026
- Chapter 1037: A Great Ruckus Jun 30, 2026
- Chapter 1036: The Bloody Massacre Jun 30, 2026
- Chapter 1035: The Perfect Shape Jun 30, 2026
- Chapter 1034: A Delighted Fight! Jun 30, 2026
- Chapter 1033: I Can Deal With Him! Jun 30, 2026
- Chapter 1032: That Blood Shield Again Jun 30, 2026
- Chapter 1031: A Bloody Battle Jun 30, 2026
- Chapter 1030: Protect the Territory Jun 30, 2026
- Chapter 1029: Crystal Eater Jun 30, 2026
- Chapter 1028: Renovator Jun 30, 2026
- Chapter 1027: Come with me! Jun 30, 2026
- Chapter 1026: Frantic! Jun 30, 2026
- Chapter 1025: Play to the gallery? Jun 30, 2026
- Chapter 1024: A kiss for one hundred years Jun 30, 2026
- Chapter 1023: You look like my lady, who has been missing fo Jun 30, 2026
- Chapter 1022: Caning the passionate couple? Jun 30, 2026
- Chapter 1021: The First Generation Jun 30, 2026
- Chapter 1020: Women’s Intuition Jun 30, 2026
- Chapter 1019: Destruction Power Upanishad Jun 30, 2026
- Chapter 1018: Traceable to the Same Stock Jun 30, 2026
- Chapter 1017: The Shocking Secrets! Jun 30, 2026
- Chapter 1016: Break the Ice! Jun 30, 2026
- Chapter 1015: We Seem to Have Some Relations Jun 30, 2026
- Chapter 1014: A Youngster of the Dark Clan Jun 30, 2026
- Chapter 1013: Proactively Kill! Jun 30, 2026
- Chapter 1012: Dark Shadow Clan Jun 30, 2026
- Chapter 1011: Shadow Ghostly Prison Jun 30, 2026
- Chapter 1010: When Words Get Sore, Adding More Words is Usel Jun 30, 2026
- Chapter 1009: The Shield has Become Heavier Jun 30, 2026
- Chapter 1008: Receive Help From a Savior Jun 30, 2026
- Chapter 1007: The Giant Blood Shield Jun 30, 2026
- Chapter 1006: Who Can Endure a Battle? Jun 30, 2026
- Chapter 1005: The Thunder God Spear Jun 30, 2026
- Chapter 1004: Giving Energy Jun 30, 2026
- Chapter 1003: Better Not to Meet Jun 30, 2026
- Chapter 1002: The Blood Blade Comes Out of its Sheath Jun 30, 2026
- Chapter 1001: Eat Meat Jun 30, 2026
- Chapter 1000: A Former Pursuer Jun 30, 2026
- Chapter 999: Crisis – Opportunity! Jun 30, 2026
- Chapter 998: The Third Sky of Original God Realm! Jun 30, 2026
- Chapter 997: Inexplicable Shock Jun 30, 2026
- Chapter 996: Send Them Off! Jun 30, 2026
- Chapter 995: Xuan Ming and Zuo Shi Jun 30, 2026
- Chapter 994: The Potion and Tool Pavilion’s Crisis Jun 30, 2026
- Chapter 993: Generous Gift! Jun 30, 2026
- Chapter 992: This Book? Jun 30, 2026
- Chapter 991: Seven Emotion and Six Desire Liquor Jun 30, 2026
- Chapter 990: Ancient City Battleship Jun 30, 2026
- Chapter 989: Travel with a Beauty Jun 30, 2026
- Chapter 988: Today Jun 30, 2026
- Chapter 987: Make the Imprint Jun 30, 2026
- Chapter 986: Power Upanishad in the Bloodline Jun 30, 2026
- Chapter 985: Blood Devil Jun 30, 2026
- Chapter 984: Exchange Information Jun 30, 2026
- Chapter 983: The Information that is Worth Ten Million Jun 30, 2026
- Chapter 982: Expand the Sea of Consciousness Jun 30, 2026
- Chapter 981: You like him? Jun 30, 2026
- Chapter 980: Refine Thousand Fold Lotus Jun 30, 2026
- Chapter 979: Immense Wealth Jun 30, 2026
- Chapter 978: The most distinguished guest Jun 30, 2026
- Chapter 977: Reunion Jun 30, 2026
- Chapter 976: Devil Blood Star Jun 30, 2026
- Chapter 975: Fu Wei Jun 30, 2026
- Chapter 974: Potion and Tool Pavilion Jun 30, 2026
- Chapter 973: Master and Servant Jun 30, 2026
- Chapter 972: After all, who is he? Jun 30, 2026
- Chapter 971: Stop there! Jun 30, 2026
- Chapter 970: Shi Yan’s Guarantee Jun 30, 2026
- Chapter 969: Ghost Hunter at This Moment Jun 30, 2026
- Chapter 968: Gu Mo Jun 30, 2026
- Chapter 967: Evil Dragon’s Natural Instincts Jun 30, 2026
- Chapter 966: Black Water Star Jun 30, 2026
- Chapter 965: Soul Refining Pool Jun 30, 2026
- Chapter 964: I’m sure I’ll handle it! Jun 30, 2026
- Chapter 963: Expel Jun 30, 2026
- Chapter 962: Soul changing! Jun 30, 2026
- Chapter 961: Inexorable doom Jun 30, 2026
- Chapter 960: Evil Dragon McGee Jun 30, 2026
- Chapter 959: Butcher the Chicken with the Cattle Knife Jun 30, 2026
- Chapter 958: Meddle! Jun 30, 2026
- Chapter 957: Three Souls Jun 30, 2026
- Chapter 956: Thorough Comprehension Jun 30, 2026
- Chapter 955: An Eccentric Man Jun 30, 2026
- Chapter 954: Sharpening Jun 30, 2026
- Chapter 953: The World of Shadows Jun 30, 2026
- Chapter 952: Vicious Natural Instincts Jun 30, 2026
- Chapter 951: Space Spider Web Jun 30, 2026
- Chapter 950: Inevitable Fierce Combat Jun 30, 2026
- Chapter 949: The Star Area Split Jun 30, 2026
- Chapter 948: Inheritance Jun 30, 2026
- Chapter 947: Death and Life Bridge Jun 30, 2026
- Chapter 946: Lift the Siege Jun 30, 2026
- Chapter 945: Revive the Deathtrap Jun 30, 2026
- Chapter 944: Whereabouts Disclosed Jun 30, 2026
- Chapter 943: Connect Two Places! Jun 30, 2026
- Chapter 942: Consequences of Having a Lousy Mouth Jun 30, 2026
- Chapter 941: It’s Dark. Please Close Your Eyes Jun 30, 2026
- Chapter 940: Enemies on a Narrow Road Jun 30, 2026
- Chapter 939: Immortal Grass Jun 30, 2026
- Chapter 938: Becoming Enemies Jun 30, 2026
- Chapter 937: Broken Star Field Jun 30, 2026
- Chapter 936: A Hug Jun 30, 2026
- Chapter 935: Opportunity Jun 30, 2026
- Chapter 934: Proper Arrangement Jun 30, 2026
- Chapter 933: Blood is Boiling! Perfect Form? Jun 30, 2026
- Chapter 932: Blood Replacement! Jun 30, 2026
- Chapter 931: Occupy All Advantages Jun 30, 2026
- Chapter 930: Well Played! Jun 30, 2026
- Chapter 929: Outsmart Jun 30, 2026
- Chapter 928: Open the Heart Jun 30, 2026
- Chapter 927: Blue Ice Jar Jun 30, 2026
- Chapter 926: Treasury Jun 30, 2026
- Chapter 925: Big Business Jun 30, 2026
- Chapter 924: A Reward of One Million Jun 30, 2026
- Chapter 923: Taboo Power Jun 30, 2026
- Chapter 922: Energy Divergence Jun 30, 2026
- Chapter 921: You’re Dead Jun 30, 2026
- Chapter 920: Today, I Come to Fulfill My Pledge! Jun 30, 2026
- Chapter 919: Blood Halberd Jun 30, 2026
- Chapter 918: A Long, Lonely journey Jun 30, 2026
- Chapter 917: Yang Tian Emperor is Well Prepared Jun 30, 2026
- Chapter 916: The Ransom of Seven Hundred Thousand Divine Cry Jun 30, 2026
- Chapter 915: Harvest Jun 30, 2026
- Chapter 914: The Mysterious Ancient City Jun 30, 2026
- Chapter 913: Fix the ancient formation Jun 30, 2026
- Chapter 912: Myriad Weighty Stone Jun 30, 2026
- Chapter 911: Thousand Fold Lotus Jun 30, 2026
- Chapter 910: One thousand miles underground Jun 30, 2026
- Chapter 909: A great migration Jun 30, 2026
- Chapter 908: Her News Jun 30, 2026
- Chapter 907: The Sole God Jun 30, 2026
- Chapter 906: Original God Realm! Jun 30, 2026
- Chapter 905: Two Souls Jun 30, 2026
- Chapter 904: Witness Billions of Years Pass By Jun 30, 2026
- Chapter 903: Seize the Origin! Jun 30, 2026
- Chapter 902: The Heaven Flame that Ranks First Jun 30, 2026
- Chapter 901: Origin Jun 30, 2026
- Chapter 900: Mysterious, Unrecognizable Land Jun 30, 2026
- Chapter 899: Immemorial Demonic Flame Jun 30, 2026
- Chapter 898: The Owner of the Incipient Extent Jun 30, 2026
- Chapter 897: An Astonishing Discovery! Jun 30, 2026
- Chapter 896: Bringing Hope Jun 30, 2026
- Chapter 895: Returned Jun 30, 2026
- Chapter 894: Connect to the Old Homeland Jun 30, 2026
- Chapter 893: A Familiar Feeling Jun 30, 2026
- Chapter 892: Ethereal Extent Jun 30, 2026
- Chapter 891: The Giant Tribe Jun 30, 2026
- Chapter 890: Living in Harmony Jun 30, 2026
- Chapter 889: The Eight Great Inheritances Jun 30, 2026
- Chapter 888: Are You the Tiny Beasts? Jun 30, 2026
- Chapter 887: Not Willing to be Mediocre Jun 30, 2026
- Chapter 886: Just Friends Jun 30, 2026
- Chapter 885: The Hollow Channel Jun 30, 2026
- Chapter 884: The Four-tiered Soul Altar Runs Away Jun 30, 2026
- Chapter 883: Struggling Jun 30, 2026
- Chapter 882: Thunderbolt Divine Light Jun 30, 2026
- Chapter 881: Awaken Jun 30, 2026
- Chapter 880: Summon the Divine Sword Jun 30, 2026
- Chapter 879: The Eccentric Smiling Face in the Stone Stele Jun 30, 2026
- Chapter 878: The Recoverer of the God Clan Jun 30, 2026
- Chapter 877: A thing of the God Clan Jun 30, 2026
- Chapter 876: Dark Prison Demonic Flower Jun 30, 2026
- Chapter 875: The demonic flower blooms Jun 30, 2026
- Chapter 874: We have many people here! Jun 30, 2026
- Chapter 873: Terrifying speculation Jun 30, 2026
- Chapter 872: Soul Confining Platform Jun 30, 2026
- Chapter 871: Follow Shi Yan! Jun 30, 2026
- Chapter 870: A change of heart Jun 30, 2026
- Chapter 869: The Remnant of Chaotic Energy Jun 30, 2026
- Chapter 868: Easygoing King of Heaven Hall Jun 30, 2026
- Chapter 867: Beseech to die Jun 30, 2026
- Chapter 866: Everybody Has A Chance Jun 30, 2026
- Chapter 865: Exchange Jun 30, 2026
- Chapter 864: Venom Crystallization Jun 30, 2026
- Chapter 863: Taking A Tonic Jun 30, 2026
- Chapter 862: Promise Jun 30, 2026
- Chapter 861: Returned To Its Rightful Owner Jun 30, 2026
- Chapter 860: Generous Gifts From The Deceased Jun 30, 2026
- Chapter 859: Intent Domain Field Jun 30, 2026
- Chapter 858: Inextinguishable Starlight Jun 30, 2026
- Chapter 857: I Think I Can Destroy You Now! Jun 30, 2026
- Chapter 856: The Wondrous Forbidden Land Jun 30, 2026
- Chapter 855: Face-to-face killing! Jun 30, 2026
- Chapter 854: Decided But Not Yet Pronounced Son-in-law Jun 30, 2026
- Chapter 853: Break the Chrysalis Jun 30, 2026
- Chapter 852: Shi Yan’s Face Jun 30, 2026
- Chapter 851: The Overcast Sky Jun 30, 2026
- Chapter 850: Blood Formation! Jun 30, 2026
- Chapter 849: Burn Your Hand, Feel the Heat Jun 30, 2026
- Chapter 848: I’m Sorry, I Will Choose Him Jun 30, 2026
- Chapter 847: A Bloody Grand Banquet Jun 30, 2026
- Chapter 846: The Giant Pale Hand Jun 30, 2026
- Chapter 845: Darkness Shrouding Jun 30, 2026
- Chapter 844: What Can We Do Then? Jun 30, 2026
- Chapter 843: The Heart of Darkness Jun 30, 2026
- Chapter 842: The Value Of Ten Thousand Top Quality Divine Cr Jun 30, 2026
- Chapter 841: Madly Striving In The Battle Jun 30, 2026
- Chapter 840: Dispute Jun 30, 2026
- Chapter 839: A Knot In The Heart Jun 30, 2026
- Chapter 838: The Dark Blood Sunset Jun 30, 2026
- Chapter 837: The Big Scarlet Shield Jun 30, 2026
- Chapter 836: Fusion Jun 30, 2026
- Chapter 835: The Mysterious Hermetic Expert Jun 30, 2026
- Chapter 834: The Frightful Invisible Hand Jun 30, 2026
- Chapter 833: Fei Lan Jun 30, 2026
- Chapter 832: The Mark Reappears Jun 30, 2026
- Chapter 831: Bet On Your Future! Jun 30, 2026
- Chapter 830: Zi Yao's secret bitterness Jun 30, 2026
- Chapter 829: Become Famous After One Battle Jun 30, 2026
- Chapter 828: Break The Ice To Get Out! Jun 30, 2026
- Chapter 827: Black Horn of the Demon Clan Jun 30, 2026
- Chapter 826: Monopolize! Jun 30, 2026
- Chapter 825: Stand Out! Jun 30, 2026
- Chapter 824: Can You Be More Shameless? Jun 30, 2026
- Chapter 823: Don’t Lean Too Close Jun 30, 2026
- Chapter 822: A Single Blade Attends a Banquet Jun 30, 2026
- Chapter 821: Conspiracy Jun 30, 2026
- Chapter 820: The Ring Spirit's instructions Jun 30, 2026
- Chapter 819: Overestimated? Jun 30, 2026
- Chapter 818: A Battle Of Wits Jun 30, 2026
- Chapter 817: Rising Winds, Scudding Clouds Jun 30, 2026
- Chapter 816: Heaven Punishment City Jun 30, 2026
- Chapter 815: An Agreement Jun 30, 2026
- Chapter 814: Outstanding Heroes’ Uproar! Jun 30, 2026
- Chapter 813: Breaking Through! Jun 30, 2026
- Chapter 812: Meet the World Extinguishing Thunder Flame agai Jun 30, 2026
- Chapter 811: The Foreign Milky Way Jun 30, 2026
- Chapter 810: Space Riot Jun 30, 2026
- Chapter 809: An Old Friend Runs Into Misfortune Jun 30, 2026
- Chapter 808: The Blood Soul Sea Jun 30, 2026
- Chapter 807: Take A Part In Jun 30, 2026
- Chapter 806: Empty Fantasy Crystal Jun 30, 2026
- Chapter 805: Bloody Chief Skull Battleship Jun 30, 2026
- Chapter 804: A Little Mercy Jun 30, 2026
- Chapter 803: A Pivotal Treasure Jun 30, 2026
- Chapter 802: Babble On The Meteorolite Jun 30, 2026
- Chapter 801: A Sensual, Bloody Battle Jun 30, 2026
- Chapter 800: Cut Dead Jun 30, 2026
- Chapter 799: Bare The Fangs Jun 30, 2026
- Chapter 798: Star Map Jun 30, 2026
- Chapter 797: Undying Wood Jun 30, 2026
- Chapter 796: Hiding Incompetence By Keeping Quiet Jun 30, 2026
- Chapter 795: Small Character, Big Effect! Jun 30, 2026
- Chapter 794: A Dark Enchainment Jun 30, 2026
- Chapter 793: Meet Up In Precincts Jun 30, 2026
- Chapter 792: Calm Down And Break The Barriers Jun 30, 2026
- Chapter 791: Disappear Quietly Jun 30, 2026
- Chapter 790: Forbidden Area’s Wonder Jun 30, 2026
- Chapter 789: Deterrent Force! Jun 30, 2026
- Chapter 788: Break Into The Prohibited Area Jun 30, 2026
- Chapter 787: Counter-attack Jun 30, 2026
- Chapter 786: Break The Illusions! Jun 30, 2026
- Chapter 785: Thousand Fantasy Fields Domain Jun 30, 2026
- Chapter 784: The Cunning Old Fellow Jun 30, 2026
- Chapter 783: Wear The Domains! Jun 30, 2026
- Chapter 782: King God Realm! Jun 30, 2026
- Chapter 781: Create a Miracle! Jun 30, 2026
- Chapter 780: The King's Heart Jun 30, 2026
- Chapter 779: A Frightening Change Jun 30, 2026
- Chapter 778: True Colors Jun 30, 2026
- Chapter 777: Getting Stronger! Jun 30, 2026
- Chapter 776: Pick the Tough Target to Start! Jun 30, 2026
- Chapter 775: Dead Sky! Jun 30, 2026
- Chapter 774: Rip the sky! Jun 30, 2026
- Chapter 773: A much valuable battle Jun 30, 2026
- Chapter 772: Seek battle! Jun 30, 2026
- Chapter 771: Leaving alone Jun 30, 2026
- Chapter 770: Within one hundred years, I will take the head Jun 30, 2026
- Chapter 769: Mutually losing face Jun 30, 2026
- Chapter 768: Hiding weaknesses by keeping quiet Jun 30, 2026
- Chapter 767: Kill a chicken with a butcher’s knife Jun 30, 2026
- Chapter 766: Undercurrent Jun 30, 2026
- Chapter 765: Purgatory Star Jun 30, 2026
- Chapter 764: The dawn of blood changing Jun 30, 2026
- Chapter 763: Demon Blood molds the body! Jun 30, 2026
- Chapter 762: Scarlet Mark! Jun 30, 2026
- Chapter 761: Dark Magnetic Deadly Explosion Jun 30, 2026
- Chapter 760: Convergence of the Moon’s brilliance! Jun 30, 2026
- Chapter 759: The Purgatory Token Jun 30, 2026
- Chapter 758: Heaven flame’s ascension Jun 30, 2026
- Chapter 757: Refine divine weapon! Jun 30, 2026
- Chapter 756: The best quality bone material Jun 30, 2026
- Chapter 755: Source of Upanishad inheritance Jun 30, 2026
- Chapter 754: Glorious Amethyst Star Jun 30, 2026
- Chapter 753: Resolutely reject Jun 30, 2026
- Chapter 752: Dirck Jun 30, 2026
- Chapter 751: Repel the enemy! Jun 30, 2026
- Chapter 750: Call me senior! Jun 30, 2026
- Chapter 749: Chaos Upanishad Jun 30, 2026
- Chapter 748: Soul Nirvana Jun 30, 2026
- Chapter 747: The Third Sky of True God Realm Jun 30, 2026
- Chapter 746: Power Upanishad Sublimated! Jun 30, 2026
- Chapter 745: Sun Original Essence! Jun 30, 2026
- Chapter 744: Original Magnetic Field Jun 30, 2026
- Chapter 743: Vermilion Bird - the Sacred Beast Jun 30, 2026
- Chapter 742: Compensate Jun 30, 2026
- Chapter 741: New comprehension! Jun 30, 2026
- Chapter 740: Can't choose the right way because of the flurr Jun 30, 2026
- Chapter 739: Volcano crystal nucleus Jun 30, 2026
- Chapter 738: Sun Brilliance! Jun 30, 2026
- Chapter 737: Outer Space God Light Jun 30, 2026
- Chapter 736: Do you have... mental problems? Jun 30, 2026
- Chapter 735: Lost Jun 30, 2026
- Chapter 734: Bloody Slaughterer Ka Tuo Jun 30, 2026
- Chapter 733: Share the hardship Jun 30, 2026
- Chapter 732: Zi Yao’s Promise Jun 30, 2026
- Chapter 731: Space Pirates Jun 30, 2026
- Chapter 730: The Solar Star Exploding Fragment Field Jun 30, 2026
- Chapter 729: Fabricate a new identity Jun 30, 2026
- Chapter 728: The feudal vassal admits his defeat Jun 30, 2026
- Chapter 727: Soul Burial Ground Deadly Upanishad! Jun 30, 2026
- Chapter 726: Upanishad advancement Jun 30, 2026
- Chapter 725: Exposed! Jun 30, 2026
- Chapter 724: A quota Jun 30, 2026
- Chapter 723: Feudal Vassal of a region Jun 30, 2026
- Chapter 722: A battle appointment Jun 30, 2026
- Chapter 721: The Moving Temporary Imperial Abode Jun 30, 2026
- Chapter 720: The value of Shi Yan Jun 30, 2026
- Chapter 719: Break the chest! Jun 30, 2026
- Chapter 718: Princess Zi Yao Jun 30, 2026
- Chapter 717: The God Domain Jun 30, 2026
- Chapter 716: Big business deal Jun 30, 2026
- Chapter 715: Raging Flame Star Area Jun 30, 2026
- Chapter 714: Breaking through in adversity! Jun 30, 2026
- Chapter 713: Shake and roam Jun 30, 2026
- Chapter 712: Miss Bi Rou Jun 30, 2026
- Chapter 711: Quenching the body to the acme Jun 30, 2026
- Chapter 710: Human body medicinal cauldron Jun 30, 2026
- Chapter 709: The Sixth Herbal Star Jun 30, 2026
- Chapter 708: Separate Jun 30, 2026
- Chapter 707: The three major God Realms Jun 30, 2026
- Chapter 706: Forced to exploit the ores Jun 30, 2026
- Chapter 705: Mining area in the foreign land Jun 30, 2026
- Chapter 704: The road of the vanguard Jun 30, 2026
- Chapter 703: Devouring Original Essence Jun 30, 2026
- Chapter 702: God Body? Jun 30, 2026
- Chapter 701: Heaven flames’ fierce battle Jun 30, 2026
- Chapter 700: Volunteer Jun 30, 2026
- Chapter 699: Meteorolite Sea Jun 30, 2026
- Chapter 698: Hope of dawn in the middle of the ruins Jun 30, 2026
- Chapter 697: Desolate deathly stillness Jun 30, 2026
- Chapter 696: Open Jun 30, 2026
- Chapter 695: Undying Demon Tribe Jun 30, 2026
- Chapter 694: Drawing of Lao Luo Jun 30, 2026
- Chapter 693: The Mark Jun 30, 2026
- Chapter 692: Derive the inheritance! Jun 30, 2026
- Chapter 691: The statues of the Demogorgon Jun 30, 2026
- Chapter 690: Yin Spirit Ghost Flame Jun 30, 2026
- Chapter 689: The Second Demon Area Jun 30, 2026
- Chapter 688: Ancient Desolate Area, Border Sea Jun 30, 2026
- Chapter 687: Put down Jun 30, 2026
- Chapter 686: True God Realm Jun 30, 2026
- Chapter 685: The Three-tiered Soul Sacrificial Altar Jun 30, 2026
- Chapter 684: The Seal of Upanishad of the lasting mark Jun 30, 2026
- Chapter 683: Advance together Jun 30, 2026
- Chapter 682: A new world! Jun 30, 2026
- Chapter 681: That’s how we work! Jun 30, 2026
- Chapter 680: Demon Testing Needle Jun 30, 2026
- Chapter 679: Drink Jun 30, 2026
- Chapter 678: Soul fragments Jun 30, 2026
- Chapter 677: Another entrance of the Secret Domain Jun 30, 2026
- Chapter 676: Destiny pronounces your sentence Jun 30, 2026
- Chapter 675: Marvelous law Jun 30, 2026
- Chapter 674: I don’t need them! Jun 30, 2026
- Chapter 673: Hundreds of flowers blossom Jun 30, 2026
- Chapter 672: We believe in Old Long! Jun 30, 2026
- Chapter 671: Behead! Jun 30, 2026
- Chapter 670: Engulf! Jun 30, 2026
- Chapter 669: Changes in earth and heaven! Jun 30, 2026
- Chapter 668: Hit until she vomits the pellets! Jun 30, 2026
- Chapter 667: Purgatory of heart Jun 30, 2026
- Chapter 666: The Utmost Eight Jun 30, 2026
- Chapter 665: Naked provocation! Jun 30, 2026
- Chapter 664: Change the structure! Jun 30, 2026
- Chapter 663: Leave the rest to me Jun 30, 2026
- Chapter 662: Five Elements Primitive Realm Jun 30, 2026
- Chapter 661: The perpetual light that never extinguishes! Jun 30, 2026
- Chapter 660: Offer sacrifices to the divine weapon! Jun 30, 2026
- Chapter 659: Headshot! Jun 30, 2026
- Chapter 658: Then we fight! Jun 30, 2026
- Chapter 657: Inextricable! Jun 30, 2026
- Chapter 656: Qi Tian Odie Jun 30, 2026
- Chapter 655: No way back! Jun 30, 2026
- Chapter 654: Master Acceptance Ceremony Jun 30, 2026
- Chapter 653: Wind and clouds move! Jun 30, 2026
- Chapter 652: I’m the Master! Jun 30, 2026
- Chapter 651: Dispel visitors Jun 30, 2026
- Chapter 650: Construct the city walls Jun 30, 2026
- Chapter 649: A beam of hope for dawn Jun 30, 2026
- Chapter 648: Deep affection – Generous love Jun 30, 2026
- Chapter 647: Impasse? Jun 30, 2026
- Chapter 646: No return! Jun 30, 2026
- Chapter 645: Contact the foreign land Jun 30, 2026
- Chapter 644: Corpse Clan's Soul Sacrificial Altar Jun 30, 2026
- Chapter 643: King of Perpetual Night Forest Jun 30, 2026
- Chapter 642: Upgrade the whole body! Jun 30, 2026
- Chapter 641: Parting ways Jun 30, 2026
- Chapter 640: Demon Clan? God Clan? Jun 30, 2026
- Chapter 639: Repercussion Jun 30, 2026
- Chapter 638: Negative field! Jun 30, 2026
- Chapter 637: Tit for tat! Jun 30, 2026
- Chapter 636: Fierce man! Jun 30, 2026
- Chapter 635: Yang Tian Emperor gets crazy! Jun 30, 2026
- Chapter 634: Mind perception Jun 30, 2026
- Chapter 633: Apprehend Jun 30, 2026
- Chapter 632: Wicked genius! Jun 30, 2026
- Chapter 631: Fire and Ice Secret Domain Jun 30, 2026
- Chapter 630: The Creator’s Divine Pond! Jun 30, 2026
- Chapter 629: Everyone takes a step back Jun 30, 2026
- Chapter 628: Kill him! Jun 30, 2026
- Chapter 627: If we want to do it, leave no room for maneuver Jun 30, 2026
- Chapter 626: The Star Original Essence Jun 30, 2026
- Chapter 625: Mirror Lake Jun 30, 2026
- Chapter 624: Breaking rules! Jun 30, 2026
- Chapter 623: Demonic beast sheds the mortal skin Jun 30, 2026
- Chapter 622: Good friendship Jun 30, 2026
- Chapter 621: Befriend Monsters Jun 30, 2026
- Chapter 620: New situation! Jun 30, 2026
- Chapter 619: Frantically great refining! Jun 30, 2026
- Chapter 618: Later happiness? Jun 30, 2026
- Chapter 617: Rupture Jun 30, 2026
- Chapter 616: Run counter Jun 30, 2026
- Chapter 615: I have something to say! Jun 30, 2026
- Chapter 614: Change Jun 30, 2026
- Chapter 613: Blood animosity Jun 30, 2026
- Chapter 612: Ancient Mark Jun 30, 2026
- Chapter 611: The Ancient ‘Bao’ (Cruel) Family Jun 30, 2026
- Chapter 610: Bao Ao Jun 30, 2026
- Chapter 609: Opportunity Jun 30, 2026
- Chapter 608: Ringleader Jun 30, 2026
- Chapter 607: Catastrophe Jun 30, 2026
- Chapter 606: Separate Jun 30, 2026
- Chapter 605: Underworld God Sacrifice Jun 30, 2026
- Chapter 604: Dark Sea overflows Jun 30, 2026
- Chapter 603: The Race Catastrophe Jun 30, 2026
- Chapter 602: Ghost Hunter breaks through! Jun 30, 2026
- Chapter 601: Refining secret treasures Jun 30, 2026
- Chapter 600: Golden Marrow Jun 30, 2026
- Chapter 599: Wash the soul Jun 30, 2026
- Chapter 598: The Gold Giant Jun 30, 2026
- Chapter 597: Heaven Flame Divine Refining Technique! Jun 30, 2026
- Chapter 596: Corpse Clan Jun 30, 2026
- Chapter 595: Refining corpses Jun 30, 2026
- Chapter 594: Legend Jun 30, 2026
- Chapter 593: Changing Jun 30, 2026
- Chapter 592: Apprehending Jun 30, 2026
- Chapter 591: Mediocre! Jun 30, 2026
- Chapter 590: Aftermath Jun 30, 2026
- Chapter 589: Burn the soul! Jun 30, 2026
- Chapter 588: Cracks in the blue dome of heaven! Jun 30, 2026
- Chapter 587: Bitter struggle Jun 30, 2026
- Chapter 586: Overdrawing Jun 30, 2026
- Chapter 585: Molting! Jun 30, 2026
- Chapter 584: Immortal body! Jun 30, 2026
- Chapter 583: Fate fusion Jun 30, 2026
- Chapter 582: Shake the God! Jun 30, 2026
- Chapter 581: Fierce battle Jun 30, 2026
- Chapter 580: Counter-attack! Jun 30, 2026
- Chapter 579: Instigating Jun 30, 2026
- Chapter 578: Divine Weapon! Jun 30, 2026
- Chapter 577: Ten Antiquity Clans Jun 30, 2026
- Chapter 576: Touching Jun 30, 2026
- Chapter 575: Earth Forbidden Technique Jun 30, 2026
- Chapter 574: Exceptionally envious Jun 30, 2026
- Chapter 573: Seven-leaflet Soul Cutting Grass Jun 30, 2026
- Chapter 572: Sky Destroyer Jun 30, 2026
- Chapter 571: Push through shoving and bumping Jun 30, 2026
- Chapter 570: The Ancient Cave Mansion Jun 30, 2026
- Chapter 569: Unforeseen event arises Jun 30, 2026
- Chapter 568: The Subterranean World Jun 30, 2026
- Chapter 567: Shady Firmament Old Mound Jun 30, 2026
- Chapter 566: Heaven Thunder Beast Jun 30, 2026
- Chapter 565: Wonderful Stone City Jun 30, 2026
- Chapter 564: Fusing light energy! Jun 30, 2026
- Chapter 563: Big Dipper God Arrow Jun 30, 2026
- Chapter 562: Evil reputation Jun 30, 2026
- Chapter 561: Wide gap Jun 30, 2026
- Chapter 560: Agreed Jun 30, 2026
- Chapter 559: Exposed Jun 30, 2026
- Chapter 558: Radiant God Cult’s Master Jun 30, 2026
- Chapter 557: Spirit Realm! Jun 30, 2026
- Chapter 556: Virescent soul sea Jun 30, 2026
- Chapter 555: Space changes! Jun 30, 2026
- Chapter 554: Dark Spirit Clan Jun 30, 2026
- Chapter 553: Repair rare treasures Jun 30, 2026
- Chapter 552: Self-torture Jun 30, 2026
- Chapter 551: Blood Pupils Jun 30, 2026
- Chapter 550: Force meets force! Jun 30, 2026
- Chapter 549: If it's a must fight, then fight! Jun 30, 2026
- Chapter 548: The second battle! Jun 30, 2026
- Chapter 547: Comprehend Jun 30, 2026
- Chapter 546: One strike to rout Jun 30, 2026
- Chapter 545: Cousin? Jun 30, 2026
- Chapter 544: Provoking Jun 30, 2026
- Chapter 543: Calamity Jun 30, 2026
- Chapter 542: Evil wind turbulence Jun 30, 2026
- Chapter 541: Waste more effort Jun 30, 2026
- Chapter 540: Soul Dividing Jun 30, 2026
- Chapter 539: Great changes are approaching Jun 30, 2026
- Chapter 538: She’s really great Jun 30, 2026
- Chapter 537: Li Zheng Rong Jun 30, 2026
- Chapter 536: Unhurriedly enter the mountain Jun 30, 2026
- Chapter 535: Precipitous Jun 30, 2026
- Chapter 534: Gigolo? Jun 30, 2026
- Chapter 533: Hunting dead souls Jun 30, 2026
- Chapter 532: Awakening Jun 30, 2026
- Chapter 531: Spirit Hall Jun 30, 2026
- Chapter 530: The Alchemists’ Center Jun 30, 2026
- Chapter 529: Dead Soul Mountain Jun 30, 2026
- Chapter 528: Hidden danger Jun 30, 2026
- Chapter 527: Bathe in the brilliant sunlight Jun 30, 2026
- Chapter 526: Powerful purification Jun 30, 2026
- Chapter 525: Self-reliance Jun 30, 2026
- Chapter 524: Desperate! Jun 30, 2026
- Chapter 523: Seven-colored Poison Technique Jun 30, 2026
- Chapter 522: Icebound earth and firmament Jun 30, 2026
- Chapter 521: Tender aroma Jun 30, 2026
- Chapter 520: Understand tacitly Jun 30, 2026
- Chapter 519: Strong-bonded sisterhood Jun 30, 2026
- Chapter 518: Join Soul Jun 30, 2026
- Chapter 517: Unlock Bloodline Jun 30, 2026
- Chapter 516: Try to be flexible Jun 30, 2026
- Chapter 515: I was also virgin ~~~ Jun 30, 2026
- Chapter 514: One to resist three Jun 30, 2026
- Chapter 513: The Third Sky of Sky Realm! Jun 30, 2026
- Chapter 512: The withering death Jun 30, 2026
- Chapter 511: Frequency of Murderous skills Jun 30, 2026
- Chapter 510: Vanish Mind Smoke Jun 30, 2026
- Chapter 509: Put forth! Jun 30, 2026
- Chapter 508: Good root, good fruits Jun 30, 2026
- Chapter 507: All kinds of flowers bloom Jun 30, 2026
- Chapter 506: Leading the wolf into the house Jun 30, 2026
- Chapter 505: A humiliating condition Jun 30, 2026
- Chapter 504: The Decline of the Family Jun 30, 2026
- Chapter 503: Gold God Blood Jun 30, 2026
- Chapter 502: Showing Goodwill Jun 30, 2026
- Chapter 501: A tetrad together to compute perfection Jun 30, 2026
- Chapter 500: Ice, Chill, Cold, and Frost Jun 30, 2026
- Chapter 499: Surpass the limit! Jun 30, 2026
- Chapter 498: Ice Emperor City Jun 30, 2026
- Chapter 497: Two sisters of a blended family Jun 30, 2026
- Chapter 496: Retrieve Jun 30, 2026
- Chapter 495: Two beautiful sisters Jun 30, 2026
- Chapter 494: The coldest place Jun 30, 2026
- Chapter 493: Pay the favor with the body? Jun 30, 2026
- Chapter 492: Proper arrangement Jun 30, 2026
- Chapter 491: Sweep away! Jun 30, 2026
- Chapter 490: Visit the old place Jun 30, 2026
- Chapter 489: New legend! Jun 30, 2026
- Chapter 488: We’ll do as you say Jun 30, 2026
- Chapter 487: Master? Jun 30, 2026
- Chapter 486: Spoils of War Jun 30, 2026
- Chapter 485: Determine firmament and earth! Jun 30, 2026
- Chapter 484: Yang Tian Emperor Jun 30, 2026
- Chapter 483: Cao Qiu Dao Jun 30, 2026
- Chapter 482: Wind and clouds discolor Jun 30, 2026
- Chapter 481: Corpse Mount, Corpse Sea Jun 30, 2026
- Chapter 480: Showing remarkable ability Jun 30, 2026
- Chapter 479: Fulfill expectations Jun 30, 2026
- Chapter 478: Those upholding justice will find help everywhe Jun 30, 2026
- Chapter 477: Exposing Jun 30, 2026
- Chapter 476: Strong Wind Jun 30, 2026
- Chapter 475: Final decision Jun 30, 2026
- Chapter 474: Boldness Jun 30, 2026
- Chapter 473: Imposing Jun 30, 2026
- Chapter 472: Strong Crowd Jun 30, 2026
- Chapter 471: Rip in half! Jun 30, 2026
- Chapter 470: Come out! Jun 30, 2026
- Chapter 469: The War Devil Jun 30, 2026
- Chapter 468: Awaken Jun 30, 2026
- Chapter 467: Remaining might Jun 30, 2026
- Chapter 466: Second Sky of Sky Realm Jun 30, 2026
- Chapter 465: Vicious Qi overflows firmament Jun 30, 2026
- Chapter 464: Look, you are not strong enough! Jun 30, 2026
- Chapter 463: Safely Free Jun 30, 2026
- Chapter 462: Shi Yan from the Yang Family! Jun 30, 2026
- Chapter 461: The Sea Races’ Banquet Jun 30, 2026
- Chapter 460: Silver Stone Fort Jun 30, 2026
- Chapter 459: Entourage of Eight Jun 30, 2026
- Chapter 458: See clearly Jun 30, 2026
- Chapter 457: Famous reputation spreads far and wide Jun 30, 2026
- Chapter 456: The strongest warrior! Jun 30, 2026
- Chapter 455: Top Dog Jun 30, 2026
- Chapter 454: First time doing blacksmith job! Jun 30, 2026
- Chapter 453: Memory transmission Jun 30, 2026
- Chapter 452: Pacifying Jun 30, 2026
- Chapter 451: Rich Blacksmith Resources Jun 30, 2026
- Chapter 450: Wild Schemes Jun 30, 2026
- Chapter 449: The Matriarch of the Naga Tribe Jun 30, 2026
- Chapter 448: Force you to give in! Jun 30, 2026
- Chapter 447: Must change! Jun 30, 2026
- Chapter 446: Arch the eyebrow Jun 30, 2026
- Chapter 445: Attention Jun 30, 2026
- Chapter 444: Domineering Jun 30, 2026
- Chapter 443: It was good to have you here Jun 30, 2026
- Chapter 442: Reversal Jun 30, 2026
- Chapter 441: Bloody Repression Jun 30, 2026
- Chapter 440: Enter the stage! Jun 30, 2026
- Chapter 439: Strong wine grows murderous spirit Jun 30, 2026
- Chapter 438: All forces join hands Jun 30, 2026
- Chapter 437: The most difficult time comes Jun 30, 2026
- Chapter 436: A turn for the better? Shi Yan? Jun 30, 2026
- Chapter 435: Changes of Temperature in human emotions Jun 30, 2026
- Chapter 434: I like a woman who smiles at me! Jun 30, 2026
- Chapter 433: The Naga Tribe Jun 30, 2026
- Chapter 432: Seabed Jun 30, 2026
- Chapter 431: Shi Yan’s influence Jun 30, 2026
- Chapter 430: Tear the mask Jun 30, 2026
- Chapter 429: The Dark Dwellers Jun 30, 2026
- Chapter 428: The Return Journey Jun 30, 2026
- Chapter 427: Farewell Jun 30, 2026
- Chapter 426: The God Blood’s magical effects Jun 30, 2026
- Chapter 425: Exchange Jun 30, 2026
- Chapter 424: Promise Jun 30, 2026
- Chapter 423: Kill them all! Jun 30, 2026
- Chapter 422: King of Demonic Insects Jun 30, 2026
- Chapter 421: Surging tide mind Jun 30, 2026
- Chapter 420: Take it on Jun 30, 2026
- Chapter 419: Life Original Fluid Jun 30, 2026
- Chapter 418: Corpse-eating Demonic Insect Jun 30, 2026
- Chapter 417: The swamp’s terrifying changes Jun 30, 2026
- Chapter 416: Spin Cocoon Jun 30, 2026
- Chapter 415: Submitted Jun 30, 2026
- Chapter 414: Slap on the face Jun 30, 2026
- Chapter 413: The heart with a grudge Jun 30, 2026
- Chapter 412: Swallow hollow spirits Jun 30, 2026
- Chapter 411: Sentimental Selection Jun 30, 2026
- Chapter 410: The abnormal underground Jun 30, 2026
- Chapter 409: Nine types of Heaven Flames Jun 30, 2026
- Chapter 408: Restore the original shape Jun 30, 2026
- Chapter 407: Blacksmith' Secret of Success Jun 30, 2026
- Chapter 406: The Mysterious Gate Jun 30, 2026
- Chapter 405: Sky Realm Jun 30, 2026
- Chapter 404: Hit to deform it! Jun 30, 2026
- Chapter 403: Diamond Martial Spirit Jun 30, 2026
- Chapter 402: Mistaken Jun 30, 2026
- Chapter 401: Rampage Jun 30, 2026
- Chapter 400: Out of control Jun 30, 2026
- Chapter 399: Lending a helping hand Jun 30, 2026
- Chapter 398: The Northern Dipper Arrows Jun 30, 2026
- Chapter 397: Viciousness Jun 30, 2026
- Chapter 396: Mountain and River Seal Jun 30, 2026
- Chapter 395: A moment of gasping for breath Jun 30, 2026
- Chapter 394: The Insight battle Jun 30, 2026
- Chapter 393: Defeated Jun 30, 2026
- Chapter 392: Give me a position! Jun 30, 2026
- Chapter 391: Brutal killing Jun 30, 2026
- Chapter 390: Fearless Jun 30, 2026
- Chapter 389: I Know Them Jun 30, 2026
- Chapter 388: Beasts’ roars Jun 30, 2026
- Chapter 387: Seven ancient factions Jun 30, 2026
- Chapter 386: The Galaxy, the ancient corpses, and the secret Jun 30, 2026
- Chapter 385: Arrival Jun 30, 2026
- Chapter 384: New understanding Jun 30, 2026
- Chapter 383: Conception Jun 30, 2026
- Chapter 382: I will call the shots from now on Jun 30, 2026
- Chapter 381: Insight Jun 30, 2026
- Chapter 380: Turn the tide Jun 30, 2026
- Chapter 379: Faded Astral Wind Jun 30, 2026
- Chapter 378: Reaping Jun 30, 2026
- Chapter 377: Add wings to the tiger! Jun 30, 2026
- Chapter 376: Filled with golden silk threads Jun 30, 2026
- Chapter 375: The hunter Jun 30, 2026
- Chapter 374: Coming Ashore Jun 30, 2026
- Chapter 373: Punishment Jun 30, 2026
- Chapter 372: Occupying the beauty Jun 30, 2026
- Chapter 371: Bursting Attack Jun 30, 2026
- Chapter 370: Underwater beauty Jun 30, 2026
- Chapter 369: The Lake Jun 30, 2026
- Chapter 368: Hiding real competence Jun 30, 2026
- Chapter 367: The God Soul Secret Treasure Jun 30, 2026
- Chapter 366: Pathfinder Jun 30, 2026
- Chapter 365: Beasts, dangerous traps, and humans Jun 30, 2026
- Chapter 364: Virtue and Evil Jun 30, 2026
- Chapter 363: Three males and two females Jun 30, 2026
- Chapter 362: The Strange Land Jun 30, 2026
- Chapter 361: Top-class warriors Jun 30, 2026
- Chapter 360: The Northern Dipper Net Jun 30, 2026
- Chapter 359: Tell her that I am still alive Jun 30, 2026
- Chapter 358: Blessing and peril linked together Jun 30, 2026
- Chapter 357: Fame of brutality Jun 30, 2026
- Chapter 356: Looking forward to your growth Jun 30, 2026
- Chapter 355: I give you freedom Jun 30, 2026
- Chapter 354: Frenzy Jun 30, 2026
- Chapter 353: An ambush in adversity Jun 30, 2026
- Chapter 352: Using malicious tricks to hurt a woman Jun 30, 2026
- Chapter 351: Seeking wealth from danger Jun 30, 2026
- Chapter 350: My way Jun 30, 2026
- Chapter 349: Mentality change Jun 30, 2026
- Chapter 348: Mutating again Jun 30, 2026
- Chapter 347: Slaughter Jun 30, 2026
- Chapter 346: Star Wings Jun 30, 2026
- Chapter 345: Open the inheritance Jun 30, 2026
- Chapter 344: Chapter 342: Stars Gathering power Jun 30, 2026
- Chapter 343: Miracle Jun 30, 2026
- Chapter 342: The Sun God, Moon God, and Star Gods appeared a Jun 30, 2026
- Chapter 341: Presumptuous Jun 30, 2026
- Chapter 340: Lord of the future Jun 30, 2026
- Chapter 339: Sword breaks the void Jun 30, 2026
- Chapter 338: A complete fusion Jun 30, 2026
- Chapter 337: Chapter 335: Crossing arms and doing nothing Jun 30, 2026
- Chapter 336: Suicide break Jun 30, 2026
- Chapter 335: Craziness Jun 30, 2026
- Chapter 334: Separating in life, parting in death Jun 30, 2026
- Chapter 333: A big defeat Jun 30, 2026
- Chapter 332: ChiYan Jun 30, 2026
- Chapter 331: Using an ox-cleaver to carve a chicken Jun 30, 2026
- Chapter 330: Devil clouds engulfing the sky Jun 30, 2026
- Chapter 329: Regardless of consequences Jun 30, 2026
- Chapter 328: Brazen intimidation Jun 30, 2026
- Chapter 327: On the edge of life and death Jun 30, 2026
- Chapter 326: Heading to the Mountain Peak Jun 30, 2026
- Chapter 325: Regain the trust Jun 30, 2026
- Chapter 324: The strong right arm Jun 30, 2026
- Chapter 323: Stay with you Jun 30, 2026
- Chapter 322: Understanding people’s heart Jun 30, 2026
- Chapter 321: The Mutant Martial Spirit Jun 30, 2026
- Chapter 320: Investigating Jun 30, 2026
- Chapter 319: Possessed by Devil Jun 30, 2026
- Chapter 318: Understandable Jun 30, 2026
- Chapter 317: The covenant Jun 30, 2026
- Chapter 316: Hidden matters Jun 30, 2026
- Chapter 315: Dark Magnetic Noxious Mist Jun 30, 2026
- Chapter 314: Three Antiquities Jun 30, 2026
- Chapter 313: The Soul Bridge Jun 30, 2026
- Chapter 312: Not the one who is content with staying in pond Jun 30, 2026
- Chapter 311: You understand my ass! Jun 30, 2026
- Chapter 310: Violent attacks Jun 30, 2026
- Chapter 309: Aggressively fighting Jun 30, 2026
- Chapter 308: Eyes of Love Jun 30, 2026
- Chapter 307: Dare to come here and play with me in the water Jun 30, 2026
- Chapter 306: Good fortune came unexpectedly Jun 30, 2026
- Chapter 305: Joint owner Jun 30, 2026
- Chapter 304: The King Corpse made a roar Jun 30, 2026
- Chapter 303: The Superb Adjoin Corpses Flame Jun 30, 2026
- Chapter 302: Understood Jun 30, 2026
- Chapter 301: Showing the real ability Jun 30, 2026
- Chapter 300: You can't go Jun 30, 2026
- Chapter 299: Long time no see Jun 30, 2026
- Chapter 298: Great Sun Holy Light Tian Mu Jun 30, 2026
- Chapter 297: The Sun Island Jun 30, 2026
- Chapter 296: Captives Jun 30, 2026
- Chapter 295: It's not because of you Jun 30, 2026
- Chapter 294: Soul Confrontation Jun 30, 2026
- Chapter 293: Spiritual Qi Bullets Jun 30, 2026
- Chapter 292: Holy Spirit God Jun 30, 2026
- Chapter 291: Looking at each other from a space distance Jun 30, 2026
- Chapter 290: Dragon Horn Clan - Ma Qi Jie Jun 30, 2026
- Chapter 289: Shi Yan’s request Jun 30, 2026
- Chapter 288: The invitation of the Three Gods Sect Jun 30, 2026
- Chapter 287: The Declaration of Love Jun 30, 2026
- Chapter 286: Strong Jun 30, 2026
- Chapter 285: Confrontation Jun 30, 2026
- Chapter 284: Visitors Jun 30, 2026
- Chapter 283 - The Peak Earth Realm Jun 30, 2026
- Chapter 282 - Determination Jun 30, 2026
- Chapter 281: Listening to the Earth's movements Jun 30, 2026
- Chapter 280 - Awaiting the Emperor Jun 30, 2026
- Chapter 277 - Rooting Jun 30, 2026
- Chapter 276 - The big picture Jun 30, 2026
- Chapter 275 - Who are you after all? Jun 30, 2026
- Chapter 274 - The Kele Clan Jun 30, 2026
- Chapter 273 - Spirit Gear inside the Flying Shuttle Jun 30, 2026
- Chapter 272 - Snow Dragon Island Jun 30, 2026
- Chapter 271 - The path to return (the way home) Jun 30, 2026
- Chapter 270 - Make you my Master Jun 30, 2026
- Chapter 269 - Confine it! Jun 30, 2026
- Chapter 268 - The Great Destruction Jun 30, 2026
- Chapter 267 - I can help you Jun 30, 2026
- Chapter 266 - Peculiar treasure appeared Jun 30, 2026
- Chapter 265 - The Nine Serenities Soul Devouring Flame Jun 30, 2026
- Chapter 264 - Breaking the shelter Jun 30, 2026
- Chapter 263 - Watch me! Jun 30, 2026
- Chapter 262 - Intimidating Heavenly Prestigious Power Jun 30, 2026
- Chapter 261 - Ruthless Jun 30, 2026
- Chapter 260 - Didn’t consider them humans Jun 30, 2026
- Chapter 259 - Mercy Jun 30, 2026
- Chapter 258 - Hunting Jun 30, 2026
- Chapter 257 - The younger generation who surpassed the older Jun 30, 2026
- Chapter 256 - Raving waves Jun 30, 2026
- Chapter 255 - Soul perception Jun 30, 2026
- Chapter 254 - Unexpected cake from Heaven Jun 30, 2026
- Chapter 253 - Desire wealth in Shiger Jun 30, 2026
- Chapter 252 - God’s Will Jun 30, 2026
- Chapter 251 - Arrogant Bluster Jun 30, 2026
- Chapter 250 - What is there to be scared of? Jun 30, 2026
- Chapter 249 - Transformation of the sea of consciousness Jun 30, 2026
- Chapter 248 - Casually Response Jun 30, 2026
- Chapter 247 - Bad things turned out to be good Jun 30, 2026
- Chapter 246 - History repeated Jun 30, 2026
- Chapter 245 - He is very special Jun 30, 2026
- Chapter 244 - Five Devils Condensation Refining Jun 30, 2026
- Chapter 243 - Give me a reason Jun 30, 2026
- Chapter 242 - Totally wiped out Jun 30, 2026
- Chapter 241 - Birdman Jun 30, 2026
- Chapter 240 - Everything has its conqueror Jun 30, 2026
- Chapter 239 - The Sound Beast Mountain Jun 30, 2026
- Chapter 238 - Demonic Sound Clan Jun 30, 2026
- Chapter 237 - Gigantic stone Castle Jun 30, 2026
- Chapter 238 - Absorption Jun 30, 2026
- Chapter 237 - An extraordinary treasure Jun 30, 2026
- Chapter 236: The Sun Refined Spirit Jun 30, 2026
- Chapter 235: Today was better than before Jun 30, 2026
- Chapter 234: Defeat you Jun 30, 2026
- Chapter 233: I Can Kill Them! Jun 30, 2026
- Chapter 232 - The Earth Realm Jun 30, 2026
- Chapter 231 - Breakthrough Jun 30, 2026
- Chapter 230 - Lost Jun 30, 2026
- Chapter 229 - Counter-attack Jun 30, 2026
- Chapter 228 - Turn the Tide Jun 30, 2026
- Chapter 227 - You Really Surprised Me! Jun 30, 2026
- Chapter 226 - You Guys Go First! Jun 30, 2026
- Chapter 225 - Ambush Jun 30, 2026
- Chapter 224 - Meteor Array Jun 30, 2026
- Chapter 223 - The Chasm Battlefield Jun 30, 2026
- Chapter 222 - Famous Jun 30, 2026
- Chapter 221 - Peak of the Disaster Realm Jun 30, 2026
- Chapter 220 - There is no need to be so direct, right ? Jun 30, 2026
- Chapter 219 - So Lame! Jun 30, 2026
- Chapter 218 - The Demon Ghost Showed its viciousness Jun 30, 2026
- Chapter 217 - The Power Rankings Jun 30, 2026
- Chapter 216 - Sky-breaking Shuttle Jun 30, 2026
- Chapter 215 - Three choices Jun 30, 2026
- Chapter 214 - We Belong Together! Jun 30, 2026
- Chapter 213 - The Ancient Gate of Heaven Jun 30, 2026
- Chapter 212 - The Change Jun 30, 2026
- Chapter 211 - Beast Ghost Jun 30, 2026
- Chapter 210 - You“re really something Jun 30, 2026
- Chapter 209 - Formed the Consciousness Sea Jun 30, 2026
- Chapter 208 - Magic Effects of Divine Blood Jun 30, 2026
- Chapter 207 - Ancient Divine Blood Jun 30, 2026
- Chapter 206 - I Bet! Jun 30, 2026
- Chapter 205 - The Yang Family’s Challenge Jun 30, 2026
- Chapter 204 - The Yang Family Jun 30, 2026
- Chapter 203 - Arrival Jun 30, 2026
- Chapter 202 - Destroy the Mountain Jun 30, 2026
- Chapter 201 - I’m Your Elder Brother! Jun 30, 2026
- Chapter 200 - Seven Magical Shifts Jun 30, 2026
- Chapter 199 - Rampage Jun 30, 2026
- Chapter 198 - Insight the danger Jun 30, 2026
- Chapter 197 - It’s My Turn! Jun 30, 2026
- Chapter 196 - The Spotlight Turned Jun 30, 2026
- Chapter 195 - Harsh Enemy Jun 30, 2026
- Chapter 194 - Now You Are convinced Jun 30, 2026
- Chapter 193 - Thriller Jun 30, 2026
- Chapter 192 - The Shadow at Dark Night Jun 30, 2026
- Chapter 191 - Black Scale Tribe Jun 30, 2026
- Chapter 190 - The invasion of Demon Dwellers Jun 30, 2026
- Chapter 189 - Exit Jun 30, 2026
- Chapter 188 - Evolution of twin martial spirits Jun 30, 2026
- Chapter 187 - Refinement Jun 30, 2026
- Chapter 186 - Extreme refining Jun 30, 2026
- Chapter 185 - The gift from Ice Cold Flame Jun 30, 2026
- Chapter 184 - Approve Jun 30, 2026
- Chapter 183 - The Heart of the Volcano Jun 30, 2026
- Chapter 182 - Under the Flames Jun 30, 2026
- Chapter 181 - Winning and Losing Are Very Important Jun 30, 2026
- Chapter 180 - Depends on My Mood Jun 30, 2026
- Chapter 179 - I’ll Bet With You! Jun 30, 2026
- Chapter 178 - Wanna Bet? Jun 30, 2026
- Chapter 177 - Firecloud Island Jun 30, 2026
- Chapter 176 - Exactly How Strong? Jun 30, 2026
- Chapter 175 - Didn’t Come for Nothing! Jun 30, 2026
- Chapter 174 - Misunderstanding Jun 30, 2026
- Chapter 173 - The Beauty Fell Asleep Jun 30, 2026
- Chapter 172 - The Demon King was Alarmed Jun 30, 2026
- Chapter 171 - The Royalty Level Secret Treasure Jun 30, 2026
- Chapter 170 - Got it! Jun 30, 2026
- Chapter 169 - Octagon Demon Formation Jun 30, 2026
- Chapter 168 - Demon Master Mojito Jun 30, 2026
- Chapter 167 - Every Minute Counts Jun 30, 2026
- Chapter 166 - Cultivating a Fake Soul! Jun 30, 2026
- Chapter 165 - Scheming With Demon Dwellers Jun 30, 2026
- Chapter 164 - Promise Jun 30, 2026
- Chapter 163 - Soul Gathering Beast Jun 30, 2026
- Chapter 162 - Extort a Confession Jun 30, 2026
- Chapter 161 - I will be waiting for you! Always! Jun 30, 2026
- Chapter 160 - Soul Gathering Pool Jun 30, 2026
- Chapter 159 - Upgrade the Treasure Jun 30, 2026
- Chapter 158 - Deterrence Jun 30, 2026
- Chapter 157 - A Pleasant Journey Jun 30, 2026
- Chapter 156 - I like obedient women Jun 30, 2026
- Chapter 155 - I will save you! Jun 30, 2026
- Chapter 154 - Kill Jun 30, 2026
- Chapter 153 - Speak Out Jun 30, 2026
- Chapter 152 - Forging Secret Treasures Jun 30, 2026
- Chapter 151 - Got it Wrong? Jun 30, 2026
- Chapter 150 - UnderseaBattle Jun 30, 2026
- Chapter 149 - Soul Attack Jun 30, 2026
- Chapter 148 - Expert? Jun 30, 2026
- Chapter 147 - Hardship Jun 30, 2026
- Chapter 146 - Lying Low Jun 30, 2026
- Chapter 145 - Saved Jun 30, 2026
- Chapter 144 - Sealed in Ice for Three Years Jun 30, 2026
- Chapter 143 - Immortal Island Jun 30, 2026
- Chapter 142 - Seize the Body Jun 30, 2026
- Chapter 141 - The Iceberg Seals the Island Jun 30, 2026
- Chapter 140 - Sky Fire Jun 30, 2026
- Chapter 139 - Site-clearing Jun 30, 2026
- Chapter 138 - Fusion Jun 30, 2026
- Chapter 137 - Upheaval Jun 30, 2026
- Chapter 136 - Breaking the Constraint Jun 30, 2026
- Chapter 135 - Tip of the Iceberg Jun 30, 2026
- Chapter 134 - The Hengluo Sea Jun 30, 2026
- Chapter 133 - The Countercharge Jun 30, 2026
- Chapter 132 - The Slaughter of the Island Jun 30, 2026
- Chapter 131 - Controlling the corpses Jun 30, 2026
- Chapter 130 - The Mutation of Life and Death Jun 30, 2026
- Chapter 129 - Two Sky Corpses Jun 30, 2026
- Chapter 128 - Live on! Jun 30, 2026
- Chapter 127 - The Burial Site Jun 30, 2026
- Chapter 126 - The Second Sky of Rampage! Jun 30, 2026
- Chapter 125 - Accept as Disciple? Jun 30, 2026
- Chapter 124 - Here, On This Ship, You Are My Girl! Jun 30, 2026
- Chapter 123 - One Palace, Two Divine Lands, Three Wonderland Jun 30, 2026
- Chapter 122 - The Yin Yang Wonderland Jun 30, 2026
- Chapter 121 - A Man and A Woman Alone Jun 30, 2026
- Chapter 120 - Crossing the Sea with a Beauty Jun 30, 2026
- Chapter 119 - The Devil King Bo Xun Jun 30, 2026
- Chapter 118 - The Goddess of the Moon Jun 30, 2026
- Chapter 117 - The Change of the God Stone Jun 30, 2026
- Chapter 116 - Let Him Watch Closely! Jun 30, 2026
- Chapter 115 - Kill Everything! Jun 30, 2026
- Chapter 114 - Shi Tie’s Death Jun 30, 2026
- Chapter 113 - Poisonous Bu Bo Jun 30, 2026
- Chapter 112 - Human Realm Third Sky! Jun 30, 2026
- Chapter 111 - Immortal pills Jun 30, 2026
- Chapter 110 - You Don’t Deserve That! Jun 30, 2026
- Chapter 109 - The Shura King Jun 30, 2026
- Chapter 108 - Waiting for an Opportunity Jun 30, 2026
- Chapter 107 - Strong Aid Jun 30, 2026
- Chapter 106 - God Child Jun 30, 2026
- Chapter 105 - The Star Martial Spirit Jun 30, 2026
- Chapter 104 - Great Disaster Jun 30, 2026
- Chapter 103 - The Space Collapses Jun 30, 2026
- Chapter 102 - Nothing to Do With Me! Jun 30, 2026
- Chapter 101 - Identity Exposed Jun 30, 2026
- Chapter 100 - Endure! Jun 30, 2026
- Chapter 99 - But, I Want to Kill You! Jun 30, 2026
- Chapter 98 - Fattened Up Jun 30, 2026
- Chapter 97 - Grind! Jun 30, 2026
- Chapter 96 - Kill All the Way! Jun 30, 2026
- Chapter 95 - Desperate Fight Jun 30, 2026
- Chapter 94 - I’ll Go! Jun 30, 2026
- Chapter 93 - The God Search Skill Jun 30, 2026
- Chapter 92 - The Gate of Heaven Appears Jun 30, 2026
- Chapter 91 - Dividing the Plunder Jun 30, 2026
- Chapter 90 - The Sky Changes Jun 30, 2026
- Chapter 89 - Forming the Yin Pearls Jun 30, 2026
- Chapter 88 - Strange Scene Jun 30, 2026
- Chapter 87 - Black Formula Jun 30, 2026
- Chapter 86 - The Yin Field Jun 30, 2026
- Chapter 85 - A Co-Master Jun 30, 2026
- Chapter 84 - The Dead Swamp Jun 30, 2026
- Chapter 83 - Meeting Face to Face Jun 30, 2026
- Chapter 82 - A Step Further Jun 30, 2026
- Chapter 81 - Obsession Jun 30, 2026
- Chapter 80 - Shadowing Jun 30, 2026
- Chapter 79 - The Seal of Life and Death Jun 30, 2026
- Chapter 78 - Inheritance of the War Devil Jun 30, 2026
- Chapter 77 - Pounding Energy Jun 30, 2026
- Chapter 76 - Exquisite Figure Jun 30, 2026
- Chapter 75 - A Kiss Jun 30, 2026
- Chapter 74 - Taken Care Of! Jun 30, 2026
- Chapter 73 - The Change in the Fallen God Stone Jun 30, 2026
- Chapter 72 - Each With Their Own Schemes Jun 30, 2026
- Chapter 71 - Take Advantage of Their Weakness!! Jun 30, 2026
- Chapter 70 - The Focus of Attention Jun 30, 2026
- Chapter 69 - Believe in Me! Jun 30, 2026
- Chapter 68 - A Thorough Defeat Jun 30, 2026
- Chapter 67 - The Battle Among the Families Jun 30, 2026
- Chapter 66 - Fearless Jun 30, 2026
- Chapter 65 - Undercurrent Jun 30, 2026
- Chapter 64 - The Medicine King, Mu Xun Jun 30, 2026
- Chapter 63 - The Martial Competition Jun 30, 2026
- Chapter 62 - Unrecognized Jun 30, 2026
- Chapter 61 - Leaders of the Third Generation Jun 30, 2026
- Chapter 60 - The Endless Sea Jun 30, 2026
- Chapter 59 - The Situation Surges Jun 30, 2026
- Chapter 58 - The Plot Jun 30, 2026
- Chapter 57 - In My Hands! Jun 30, 2026
- Chapter 56 - Basalt Scriptures and the Dragon Turtle Armor Jun 30, 2026
- Chapter 55 - The Weirdo Jun 30, 2026
- Chapter 54 - Zuo Shi Jun 30, 2026
- Chapter 53 - Visitors from the Zuo Family Jun 30, 2026
- Chapter 52 - The Mysterious Area Jun 30, 2026
- Chapter 51 - The Martial Spirit Palace Jun 30, 2026
- Chapter 50 - A Cut Jun 30, 2026
- Chapter 49 - The Sky Gate and the God Area Jun 30, 2026
- Chapter 48 - The Test Jun 30, 2026
- Chapter 47 - Tianyun City Jun 30, 2026
- Chapter 46 - A Glance Jun 30, 2026
- Chapter 45 - The Change Jun 30, 2026
- Chapter 44 - Silent Town Jun 30, 2026
- Chapter 43 - Beiming Family Jun 30, 2026
- Chapter 42 - Departure Jun 30, 2026
- Chapter 41 - The Third Sky of Nascent Level Jun 30, 2026
- Chapter 40 - Sharing the Treasure Jun 30, 2026
- Chapter 39 - Three types of Flames Jun 30, 2026
- Chapter 38 - Spirit Level Martial Skills Jun 30, 2026
- Chapter 37 - The Killing Jun 30, 2026
- Chapter 36 - Bang! Jun 30, 2026
- Chapter 35 - Block the Cave Jun 30, 2026
- Chapter 34 - Mysterious Martial Spirit Jun 30, 2026
- Chapter 33 - Martial Spirit of Music Jun 30, 2026
- Chapter 32 - The Silver Thunder Wolf Jun 30, 2026
- Chapter 31 - Blue Magic Flames Jun 30, 2026
- Chapter 30 - Inside the Tree Jun 30, 2026
- Chapter 29 - Eating Human Flesh Jun 30, 2026
- Chapter 28 - The Blast Jun 30, 2026
- Chapter 27: The Three Parties Unite Jun 30, 2026
- Chapter 26 - The Wager Jun 30, 2026
- Chapter 25 - Ghost Jun 30, 2026
- Chapter 24 - Trouble Jun 30, 2026
- Chapter 23 - The Tush Mercenary Union Jun 30, 2026
- Chapter 22 - Shi Family Jun 30, 2026
- Chapter 21 - Pervert Jun 30, 2026
- Chapter 20 - Steel Himself Jun 30, 2026
- Chapter 19 - The Martial Spirit of Petrifaction Jun 30, 2026
- Chapter 18 - Being pursued Jun 30, 2026
- Chapter 17 - Ten Times of Gravity Jun 30, 2026
- Chapter 16 - Treasure Jun 30, 2026
- Chapter 15 - Promoting to Nascent-Level Warrior Jun 30, 2026
- Chapter 14 - Music from the Heaven Jun 30, 2026
- Chapter 13 - Surprise Kill Jun 30, 2026
- Chapter 12 - The Mysterious Martial Skill in the Blood Vein Jun 30, 2026
- Chapter 11 - Strike Back Jun 30, 2026
- Chapter 10 - Drag Her Down Jun 30, 2026
- Chapter 9 - The Escape Jun 30, 2026
- Chapter 8 - The Jade Blade Spider Jun 30, 2026
- Chapter 7 - The Second Sky Jun 30, 2026
- Chapter 6 - Immortal Martial Spirit Jun 30, 2026
- Chapter 5 - Lightning Martial Spirit Jun 30, 2026
- Chapter 4 - Guinea Pig Jun 30, 2026
- Chapter 3 - First encounter Jun 30, 2026
- Chapter 2 - The Body Remodelled Jun 30, 2026
- Chapter 1 - Reborn In Another World Jun 30, 2026
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.
User Comments
0 comments from readers