Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 763 - She didn’t kill your children, I did! from Great Demon King, a Fantasy novel by Ni Cang Tian.

GDK 763: She didn’t kill your children, I did!

The two charge forwards Avery’s location as though an unstoppable force. All those divine guards of Avery’s they met along the way were butchered by the two.

Miserable shrieks filled the spacious underground chamber. All those divine guards died to Han Shuo’s flying swords melted into nothing but watery blood. The bodies of those divine guards killed by Rose would also rapidly melt away when they made contact with the bloody liquid.

They were in Godswamp Pharmacy of Hushveil City. Han Shuo knew that they must plete the objective and escape from this place as soon as possible. Otherwise, if they take too long, the divine guards of Hushveil City would be at the scene and surround them in large numbers. Even with his and Rose’s extraordinary strengths, they might not be able to escape from being encircled.

Therefore, Han Shuo did not show the slightest mercy. The streams of gods were transformed into streams of blood. Han Shuo and Rose forced their way into the deepest part of the underground chamber.

While Han Shuo was conducting his killing spree, his demon generals had gone to probe ahead. He had already figured out exactly where Avery was. Therefore, Han Shuo didn’t have to waste any more time to search for him. He arrived at the tightly sealed chamber where Avery was hiding.

The Godswamp pharmacist called Kraft suddenly came running out from the room screaming. Two flying swords streaked through his neck like a beam of light. His head was severed from his body and sent spinning away, all before his voice fell. The severed end on his neck was still squirting blood when his body collapsed with a thud.

Divine energy of darkness suddenly gushed from the space behind Kraft and a darkness domain of divinity took shape in an instant. The already dim underground chamber abruptly turned into plete darkness. A shadowy figure started moving rapidly in the darkness. Its divine energy blew the bloody liquid on the ground and sprayed it towards Han Shuo and Rose.

As Rose cultivated in the energy of darkness and Han Shuo doesn’t get affected by changes in the environment in any way, nothing had escaped from their visions, including the corrosive liquids splashing towards them. Han Shuo had a calm face and uttered not a word. The seventeen flying swords shot precisely at the moving shadowy figure at lightning speed with ferocious power.

The flying swords made loud whistles that could pierce ears and souls, disrupting the mind of all those in the room. All flying swords arrived beside the shadowy figure in an instant and surrounded it, not giving it an opportunity in escaping.

While the seventeen flying swords were doing their jobs, Han Shuo moved like a shadow, evading the bloody liquid raining down at him. He shouted, “Today will be the last day of your life, Avery!”

Upon finishing those words, Cauldron Spirit’s energy flooded into his body. A most terrifying energy emanated from Han Shuo in an instant. The whistling noises grew even louder and piercing as the seventeen flying swords that trapped Avery formed Ceaseless Pain around him. A most ruthless, brutal and sinister aura was emanated.

Rose originally intended to assist Han Shuo in killing Avery but the instant that Han Shuo utilized Cauldron Spirit’s energy, she was dumbfounded. The ferocious and fear-inducing aura given off by the seventeen flying swords caused her to be overwhelmed with shock.

So it turns out that he had not even used his full strength against me. I thought I could get my revenge after he nullifies the master-slave contract. Ha, laughable, how laughable of me, thought Rose.

Even though Rose was outside the Ceaseless Pain, she was nonetheless intimidated by the terrifying energy field produced by the sword formation. She stood foolishly behind Han Shuo, not having the courage to get close to the sword formation to help attack Avery. It was also at this moment that Rose pletely gave up on making retribution against Han Shuo. She even felt a mixed feeling of dread and reverence towards him.

Rose actually knew Han Shuo better than most gods on Elysium. Back then on the Profound Continent, through her believer Adele, Rose had sensed Han Shuo and knew his strength. She never expected that Han Shuo would e to possess such terrifying strength in such a short amount of time. The rate at which his strength soars was unimaginable to Rose.

Given that Avery’s strength was below that of Rose’s and Han Shuo had boosted his strength by borrowing Cauldron Spirit’s energy, Avery was on the back foot and couldn’t even make a counterattack. The darkness divine energy in his body was assailed by the chilling aura and corrosive power of the seventeen flying swords that were trapping it in Hell. Just a short few seconds after Ceaseless Pain was formed, his heart was swarmed with the feeling of despair.

Han Shuo suddenly flew to Avery. In a callous face, he said, “By the way, Carmelita did not kill your children. I did.”

The radiance of extreme hatred and rage burst from his eyes. He seemed to be unwilling to die this way. He clenched his teeth and tried to injure Han Shuo with his death.

For unfortunately for Avery, Han Shuo would not give him the chance to do so. The seventeen flying swords flew around his chest and took away every last bit of vitality left in him. Before the poison pletely liquefied Avery, the seventeen flying swords abruptly flew aside.

Han Shuo quickly moved towards his body. He opened his left hand, deployed the Demonic Blades, and cut across Avery’s neck. As Han Shuo had deployed frigid aura, not a drop of blood left Avery’s neck.

Han Shuo then quickly took out the glass container he had long prepared, placed Avery’s head in it, and left a bit of frigid aura in the container before sealing it. Meanwhile, Cauldron Spirit flew out from Han Shuo’s body to collect Avery’s divine soul at the fastest speed possible.

Han Shuo looked all around the bloody scene. Seeing that not a soul was left alive, he promptly instructed, “TIme to leave.”

Rose was staring at Han Shuo foolishly. After hearing those whose, she softly answered an “O” and followed behind Han Shuo in silence. Amazement and fear could be seen in her bright eyes looking at Han Shuo’s back.

The whole duration of breaking into the secret chamber and murdering everyone inside did not exceed two minutes. Those who had detected abnormality under the ground of Godswamp Pharmacy had yet to make it to the tunnel entrance.

Han Shuo and Rose streaked across the tunnel and traveled on the path the came from. Soon enough, they were back at the surface. It was then that they saw the Godswamp Pharmacy divine guards who were rushing over.

Han Shuo had probed all around Godswamp Pharmacy with his demon generals before the matter and he had discovered no sign of Hassling. Currently, there wasn’t a single person in the entire Godswamp Pharmacy that could actually cause them harm.

All those divine guards who charged at the duo were simply giving away their lives. Han Shuo and Rose did not show the slightest mercy. Multiple divine guards would die horribly in an instant. After killing a few more divine guards foolish enough to block their paths, Han Shuo and Rose immediately flew away from Godswamp Pharmacy before the divine guards of Hushveil City could arrive and surround them.

The assassination was pleted cleanly and smoothly. Han Shuo and Rose escaped into the darkness of the night effortlessly.

Two bloody murders happened in Hushveil City in less than 24 hours and the crimes were mitted by the same gang. This alarmed the experts of all major family clans in Hushveil City, especially the Chief of Sixth Corps who were wildly hunting for his son’s murderers. He put about threats that once he found the murderers, he would skin them alive.

***In the Hofley Residence.

The House of Hofley was the most powerful family clan in Hushveil City. Hofs, the patriarch of the family clan, was wearing a gloomy face and in a fit of rage. The Divine Guard Chiefs of Hushveil City were all standing before him quiet still and in fear.

“Get me the murderers in three days, dead or alive!” Although the thin and tall Hofs may appear cultured and refined, all those who were acquainted with him knew that he was extremely irascible in temper. This time around, Hofs had reached the point of criticality. It had not been long since the death of one of his Divine Guard Chiefs, Eugene, before such outrageous murders occurred in his city. His anger was fanned before it could subside. He was clearly at the limits of his tolerance.

The Chiefs dared not utter a word but the Chief of Sixth Corps, Salouhucci, loudly answered, “Rest assured, my Lord. All divine guards of my Sixth Corps have been activated and all city gates have been notified not to allow any white-haired woman to leave the City. The Godswamp Pharmacy murder took place after the City lockdown and therefore, we can be certain that the murderers are still in Hushveil City. As long as we keep on searching, we will eventually find the two murderers.”

“I don’t care whatever method you use. But in three days, I want to see them, dead or alive!” shouted Hofs. “Where is Hassling?”

“My Lord, Mister Hassling is at Firesand Town. A message has been delivered. Given the short distance of Firesand Town and the City, I believe Mister Hassling will arrive soon,” said Lordaeron, the Chief of the First Corps.

Hofs suddenly slammed on his table shattered it into pieces. He shouted, “Why must they go to Godswamp Pharmacy to kill? The secret chamber was filled with dead bodies but there wasn’t one with a whole body. Who are those murdered?”

Lordaeron’s face turned astringent. He answered, “We have examined the crime scene but couldn’t learn anything useful. We will have to wait for Hassling to tell us that.”

“City Lord, the master of Godswamp Pharmacy asks for permission to enter,” it was at this moment that the voice of a divine guard sounded from outside the room.

All those in the room were waiting for Hassling. Hofs’ eyes turned cold and he shouted, “Let him in!”

Soon enough, Hassling, whose hair looked old but face looked young, walked into the room respectfully. As soon as he arrived, he gave Hofs a bow and said in a griefing voice, “Please uphold justice for me, City Lord!”

Hofs wore an irritated face. He coldly groaned, “Those died in your secret chamber, who are they?”

“Avery and his divine guards who were previously in the Fifth Corps of the City of Shadows. Avery contacted me after he had a fallout with the House of Sainte as he knew that I have disagreements with the House of Sainte. He asked me to provide them a place of shelter. As I saw how unreasonable the House of Sainte have been, seeing that Avery was sincere, and having the thought of recruit talents for Hushveil City, I agreed to help him and placed him in the secret chamber of my Godswamp Pharmacy. The House of Sainte is outrageously daring. Last time, they killed Eugene. And now, they bee even more unbridled to mit murder in Hushveil City. They clearly are challenging the sovereignty of our Hushveil City. My Lord, Hushveil CIty must not bow to them any longer!” cried Hassling tearfully.

Hassling knew that there was no way he could conceal the secret any longer, given how significant the matter was. However, in the crisis, he saw an opportunity to frame the House of Sainte that he so hates. If Hushveil City and the City of Shadows go to war – that would be wonderful. If not, at the very least, Hofs would be enraged and he would give the House of Sainte troubles.

“Avery. Turns out to be him!” Hofs furiously shouted, “Why am I not aware of this until now?”

“I do not wish to disturb Your Lordship as I know that Your Lordship is a busy man. Also, I know that the House of Sainte has been trying to track down Avery aggressively. Therefore I plan on waiting a few more days before reporting to Your Lordship. I did not expect that such a thing would happen before that. Please forgive me, my Lord. I, Hassling, have always been faithful and true to Your Lordship. Please know that I mean well, my Lord,” replied Hassling hastily.

“My Lord, as the murdered was Avery of the City of Shadows and not a member of our Hushveil City, we are somewhat in the wrong. After all, we had made a pact with Wallace that none of us in the Darkness Dominion will shelter Avery. Now that Avery was found inside the secret chamber of Godswamp Pharmacy and if the House of Sainte knows about it, we are not entirely in the right,” the Chief of Second Corps reminded softly.

“So what? Does that mean it’s justifiable for the House of Sainte to not talk about it with City Lord for His Lordship to do something about it but to intrude and mit murder in our City? Even if we don’t talk about Avery, what about my son? They openly murdered him on the street just because my son had a quarrel with them. Should we just forgive them for the matter as well? It is clear from their actions that they don’t think Hushveil City is a force to be reckoned with. If we promise now, they will only bee more and more unbridled in our soil!” shouted Salouhucci.

Hofs glanced at his quarreling Divine Guard Chiefs and then looked at Hassling. In a gloomy face, he instructed, “No matter who or what, I will not allow anyone who mitted multiple murders in my City to walk free. Send all your men to search and investigate. Once you find them, arrest them. If they resist, kill them on the spot. The City of Shadows have killed Eugene and now they are pissing all around in my Hushveil City. No matter what Wallace will say, I’m not tolerating him any longer!”

Hofs did not change his opinion even after learning about the identity of the victims and instructed to capture the murderers dead or alive. These Chiefs of Divine Guards knew that Hofs won’t be changing his opinion. They exited the room with cold faces and started assembling all the divine guards in the City for a major manhunt.

At this moment, Han Shuo and Rose who had thrown Hushveil City into utter chaos were at the most desolate part of the City. They found a new gymnasium to stay.

Before looking for a gymnasium, Rose had pletely covered her long hair with a dark headscarf to conceal the most eye-catching feature on her.

Han Shuo used his divine tablet to rent the gymnasium. He sat down peacefully in the gymnasium and did not appear worried at all.

However, Han Shuo discovered that after the murder at Godswamp Pharmacy, Rose’s gazes towards him had changed somewhat. From time to time, she would look at him with bunched brows as though there was something she wanted to ask but didn’t have the courage to.

After seeing that again and again, Han Shuo got somewhat irritated. He turned to gaze at Rose a distance away and asked, “Speak. What is it?”

Rose hesitated for a moment before she asked, “Back at Demon Mountain, why is it that you did not try to kill me right from the start? From the strength you displayed last night, if you had used your full strength against me, I would be dead without a doubt.”

Han Shuo had in fact attacked with his full strength. It was just that Cauldron Spirit wasn’t on him and therefore he couldn’t boost his strength to kill her straightforwardly. Cauldron Spirit was Han Shuo’s biggest secret. There was no way that he would tell Rose about the presence of the Cauldron Spirit. Han Shuo stared blankly at the curious and inquisitive Rose. After half the day, unable to e up with a reasonable excuse, he decided to just be condescending, “Remember your identity. Don’t ask so many questions that are irrelevant to you.”

Han Shuo then shut his eyes and mouth, not paying any more attention to Rose.

Rose turned angry. The more time she spent with Han Shuo, the more punchable Han Shuo was to her. Not only that he wouldn’t tell her a single truth about the mysteries on him, but he would also always mand her around. This filled Rose’s heart with discontent with nowhere to vent.

“When are we going to leave the City?” Rose looked at Han Shuo with hateful eyes and said, “After the one day and night of killing spree, I reckon that the entire Hushveil City is in turmoil. As you have asked me to cover my hair, you should also know that Hushveil City isn’t going to let us off. Under such circumstances, if we are found, all the experts in Hushveil City will gather and surround us. By then, even though our strengths are decent, I fear we will not be able to escape.”

Although Rose was confident in her power, she knew that there was no way she could escape from heavy encirclement. After all, just the City Lord of Hushveil City alone was enough to defeat her. If all the experts of Hushveil City were to encircle them, she believed that even Han Shuo won’t be able to escape unscathed.

“Hushveil City is currently in high alert mode. There are more divine guards on the streets than there are moners. The city gates must have all been sealed. Now is not the time to leave as it is very likely that we will be caught,” with his eyes still shut, Han Shuo lazily said, “Besides, the matter has not been pleted cleanly.”

“Aren’t they all dead already? What more do you want?” asked Rose in astonishment.

“No, there is one left. This person is even harder to deal with pared to Avery. He is the master of Godswamp Pharmacy, Hassling,” Han Shuo opened his eyes and turned to Rose, explaining, “Even if not for my grudges with Hassling, in order for Celestial Pearl to dominate the market in the Darkness Dominion, I must get rid of him.”

“You still have the guts to attack even at this moment?” Rose was astounded by how outrageously bold Han Shuo was. She cried out in surprise, “You should know that every spot in the City is filled with divine guards. They are all looking for the two of us. Isn’t it too reckless to strike again at this time?”

Han Shuo revealed a calm smile, shrugged, and consoled, “Don’t worry, I have confidence in bringing you out the City alive. Rest well for we shall head to Godswamp Pharmacy again tonight. I reckon that after such a major incident in Godswamp Pharmacy, Hassling would have returned.”

Rose wore a cold face but her mind was far from being at ease. She thought, Didin’t expect that I would end up following a lunatic. Am I really going to make it out of Hushveil City alive?

Although Rose had been alive for countless years, she had never met anyone who was as daring as Han Shuo was. Somehow, she felt a slight excitement in her heart. She was both worried and excited about their assassination later that night. She was not able to calm her heart for a long time.

You are reading Great Demon King Chapter 763 - She didn’t kill your children, I did! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Spirit Realm cover
Same author

Spirit Realm

Ni Cang Tian ·Fantasy

Thirtythousandyearsago,theHeavenFightingRacewhocalledthemselves“Gods”invadedtheSpiritRealm.Hundredsofracesroseupinresistance,butultimatelysuffereda...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Blade Over Magic cover
Same genre

Blade Over Magic

BjOmonobi4986 ·Fantasy

XanderwashailedasTheSwordmasteronearth.Whenitcametoblades,heheldnoequal.Itdidn'tmaterwhatcategoryorhowexperiencedhisopponentwas.Hewasjustbetter,and...

Walker Of The Blue Sky cover
Same genre

Walker Of The Blue Sky

RazaKarim ·Fantasy

InaworldcalledInfiniteSoulStar,thereisanextraordinarygroupthatcontrolsallkindsofincrediblepowersbymasteringtheirSoulForce.TheyarecalledSoulMasters....

Walker Of The Worlds cover
Trending now

Walker Of The Worlds

Grandvoiddaoist ·Action

LinMuwasacommonboylivinginasmalltown,ostracizedbythetownsmenbecauseofamistakehemadeduringtheharvest,hishouseseizedtocompensateforit.Forcedtofendfor...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.