Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1004: Return Trip from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1004: Return Trip

As the ground shook and rumbled, enormous gullies appeared and split the earth.

Deep in the firmament, seven-colored light flashed and cut the sky like blades.

The secret realm was collapsing, causing everyone that had just entered to pale.

Qin Lie and Zhuang Jing flashed past those people like a ray of light.

"That woman just entered yet she’s in such a hurry to leave. Something must be happening here!"

Along the way, the clansmen of different races suddenly reacted..

While they were still in a daze, Naji of the Asura Race flashed past them.

"The secret realm is about to collapse!" someone shouted.

Everyone who had entered the secret realm was startled.

They hurriedly fled towards the passageway’s entrance.

At the front, Qin Lie led by Zhuang Jing finally saw the passageway where the lights intersected.

Without any hesitation, he plunged in and fled from the secret realm that was on the verge of collapse.

Zhuang Jing, Naji, and experts of other races followed..

"Who are you? You are not one of those that came in later!"

Clansman of the Wood Race stared at Qin Lie, harsh expression on his face.

Clansmen of a dozen different races also noticed Qin Lie, their expressions being grave.

"What did you obtain in the secret realm?"

"Are you the reason for the death of all those who had entered?"

"Why did the secret realm suddenly collapse?"

They questioned Qin Lie.

Even Naji had a strange expression. He seemed to be pondering inside whether he should attack Qin Lie.

In the secret realm, the corpses of the different races had intimidated Naji.

He increasingly felt that Qin Lie's strength was unfathomable. He wasn't confident he could win against Qin Lie so he hesitated.

Leaving behind the secret realm about to explode, Qin Lie's expression relaxed. He smiled slightly and said, "The deaths of those people have nothing to do with me. They were influenced by the illusions in the secret realm, they fought and killed each other to death. When I entered, they had all died. I only just... took some spatial rings from their bodies."

"Spatial rings?" Wood Race clansman turned cold and shouted, "Return what you took from the our clansmen to us!"

"Return the Sea Race's spatial rings to us!"

"Those things belong to us!"

The remaining races also shouted.

Qin Lie laughed and glanced at Naji. He said, "I also took a few spatial rings from the Asura Race, do you want to get them back?"

Naji's eyes flashed. Then he laughed dryly and said, "My path differs from Lando’s. I have no interest in their spatial rings."

He decided not to offend Qin Lie.

"It’s good that they don’t interest you." Qin Lie smiled and looked at the other dozen people. He said, "You all want those spatial rings back?"

The foreign races’ clansmen nodded.

"Alright." Qin Lie's eyes turned cold.

Threads of extremely cold energy surged out of his body. They formed glowing ice blades in the chaotic streams of space.

With a simple thought, he sent the sharp ice blades giving off blinding light in all directions.

The surging cold energy was capable of freezing the blood and True Soul.

As the ice blade spun with Qin Lie as the center, an icy world that looked like Forbidden Land of Ice of Graveyard of Gods appeared.

In the surrounding space.

The bodies of the foreign races gave off strange cracking sounds as they slowly froze to ice.

Qin Lie's eyes were cold as he released the surging frost energy hidden in his frost natal palaces.

The dozen foreign raceas’ clansmen turned into ice statues as the ice energy spread.

No one had survived!

"The inheritance of the Ice Emperor! This is the frost power of the Ice Emperor!" Zhuang Jing couldn't help but scream. "You, you don't just cultivate the inheritance of the Thunder Emperor, you also have mastered the spirit art of the Ice Emperor! Heavens!"

Of the three emperors, she had felt the inheritance of the Thunder and Ice Emperors from Qin Lie's body.

This caused her to be even more shocked at Qin Lie's identity.

"Master. Are you... the successor to the three emperors?" Zhuang Jing asked with side eyes.

"Ice Emperor..." Naji’s expression changed slightly as well.

The three emperors of the human race were also famed among the foreign races. As a warrior of the Asura Race, he had heard the elders speak of the power of the three emperors.

Qin Lie was a master of the Thunder Emperor's inheritance power. This already shocked him. Hearing Zhuang Jing say that Qin Lie also cultivated the power of the Ice Emperor, Naji became even more astounded.

"How did you get over here?" Qin Lie did not answer. He looked at Zhuang Jing and inquired. "I want to return to Spirit Realm, can I use the path you took?"

"The path I took?" Zhuang Jing was dazed.

"I need to borrow the spatial passageway you came from," Qin Lie said.

"This... may not work." Zhuang Jing grimaced and said, "I came through Lunar Temple's spatial passageway. This entrance had been created by experts of the human Gold rank forces. This place is unusual, and doesn’t allow those above the Fragmentation Realm to enter. All the Soul Altar seniors are standing guard at the entrance."

"All the humans have died. Once you and I leave this place, we will be stopped by the human forces at the entrance and questioned."

"My status... naturally has no problems. But you?"

Zhuang Jing looked deeply at Qin Lie and said, "Master, how did you e in?"

Qin Lie's expression was dark. He said, "I had been plotted against by the Heaven Ghoul Race and accidentally pulled into the chaotic streams of space. I don’t know how to return to Spirit Realm."

"Heaven Ghoul Race?" Zhuang Jing was astounded. "Weren't they extinct? After the God Race came to Spirit Realm, they started to clean out the ghoul races. They should have been exterminated to the last."

Qin Lie did not want to waste words on the three ghoul races. He said, "In other words, the strongest of the Gold rank forces in Central World stand guard outside the entrance?"

"The eight great Gold rank forces, and sub rank one Gold rank forces such as Lunar Temple and Blue Flame Manor all have Soul Altar experts waiting there," Zhuang Jing said confidently.

Qin Lie frowned.

It was by pure accident that he came to the chaotic streams of space. As a result, he had obtained the remains of three progenitors, another five of his Spirits of Void and Chaos began their evolution, he had reached the middle stage of the Fragmentation Realm and formed his second heart.

He obtained many wondrous items in the chaotic streams of space. He had also learned more about his own identity. At this time, he wanted to return to Spirit Realm as fast as possible.

Unfortunately, he did not have a safe passageway out of this place, and he did not want to be questioned repeatedly by the strong of the Central World.

He was afraid that those people would reveal his true identity.

Just as he was vexed by this, Naji of the Asura Race suddenly said, "You don't know a way back to Spirit Realm?"

"Do you?" Qin Lie asked impatiently.

Naji was silent for a moment and said, "I cannot return to Asura World. However... I can go to another domain. Asura clansmen also live there. This place has a spatial passageway connected to Spirit Realm. However, it doesn't connect to Central World, but an extremely remote place far away. That place... seems to be called something like ‘Land of Chaos.’"

"Land of Chaos?!" Qin Lie shook.

Naji nodded. "The land I am going to belongs to a branch of the Asura Race. They are close with a Silver rank forces in the Land of Chaos called Terminator Sect. But the void passageway there can only reach the Land of Chaos, and not the Central World. Would this help you?"

"Land of Chaos?" Zhuang Jing frowned and said, "That place is extremely far from Central World. In the eyes of the human Gold rank forces of Central World, that is an uncivilized place. It doesn't even have a teleportation formation connected to Central World. If we go there, I don't know how long it would take to return to Central World."

She had always thought that Qin Lie was also from the Central World. She thought the place that Qin Lie wanted to return to was Spirit Realm's Central World.

"You can really take me back to the Land of Chaos?" Qin Lie took a deep breath and said, "Didn't you say that you were a traitor to the Asura Race? That realm connected to the Land of Chaos will allow you to borrow their spatial passageway?"

"I am a traitor of the Asura Race, but that place... is my homeland. Over there, people will be willing to help me," Naji said.

Qin Lie thought for a moment and nodded. He said, "Tell me what price I need to pay."

"Price..." Naji's eyes flashed. He laughed and said, "I have not thought of it. When I do, let's talk."

"Alright." Qin Lie nodded.

"e with me." Naji led the way.

You are reading Spirit Realm Chapter 1004: Return Trip on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Walker Of The Blue Sky cover
Same genre

Walker Of The Blue Sky

RazaKarim ·Fantasy

InaworldcalledInfiniteSoulStar,thereisanextraordinarygroupthatcontrolsallkindsofincrediblepowersbymasteringtheirSoulForce.TheyarecalledSoulMasters....

My Arms Can Turn into Blades cover
Trending now

My Arms Can Turn into Blades

Ode ·Fantasy

ChenLuSifindsastrangestoneandmeetsastrangegirlduringhistombsweeping.Afterthegirlslasheshimwithasword,hefindsthathecouldn'tcontrolhiswholebodybuthis...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.