Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1009: Miao Fengtian's Choice from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1009: Miao Fengtian's Choice

"The situation is not optimistic." Li Mu sighed softly.

Everyone's brows furrowed.

"How is... Illusory Demon Sect?" Qin Lie's gaze landed on Yu Lingwei among the crowd.

"We lost Illusory Demon Sect. Fortunately, the majority of our disciples moved in advance, and we can tolerate the losses," Yu Lingwei's expression was dim. She forced a smile. "The present Illusory Demon Sect has fallen from a Silver rank force to the Copper rank. If the eastern barbarians and the three ghoul races attack again, we will bee weaker than Sky Flame and Demon Eye that had submitted to us in the past, ah....”"

Li Mu, Xu Ran, and the others looked with sympathy at her. They all felt that Illusory Demon Sect was extremely unlucky.

When the three ghoul races invaded, Illusory Demon Sect had been besieged by external and internal enemies, and had been pletely scattered.

Black Voodoo Cult also existed on the Heavenly Slaughter Continent, but the Blue Ghoul Race chose to attack Illusory Demon Sect.

At that time in Illusory Demon Sect, Wen Bin, Chu Miaodan, and the others had been allied together in trying to supplant Yu Lingwei and take her position as sect master. They had not provided her with much help.

As a result, Yu Lingwei suffered continued losses in the fight against the Blue Ghoul Race.

The group led by Wen Bin and Chu Miaodan colluded with Black Voodoo Cult and almost caused Illusory Demon Sect to fall into their hands.

After finally managing to eliminate the three ghoul races with the help of Flaming Sun Island and Blood Fiend Sect, the eastern barbarians invaded again.

At that time, almost all the Soul Altar experts of Illusory Demon Sect had died. Only Yu Lingwei was left still standing.

Out of helplessness, she was forced to join Flaming Sun Island and bend her head to Qin Lie.

However, not long after, Qin Lie was "killed" by the eastern barbarians and the Heaven Ghoul Race. It caused Yu Lingwei to feel even more hopeless.

As the eastern barbarians moved in, as the hidden clansmen of the three ghoul races gradually came out of concealment, Illusory Demon Sect, to no one's surprise, fell.

She could only take the members of Illusory Demon Sect to live in the islands around Flaming Sun Island.

"How did Illusory Demon Sect fall so easily?" Qin Lie frowned.

"The eastern barbarians' offensive was too strong. Adding on the three ghoul races appearing again, we... were unable to stop them at the start," Song Tingyu said helplessly.

"Heavenly Sword Mountain and Terminator Sect was unable to e immediately and help Flaming Sun Island. When we gathered our forces and arrived, Illusory Demon Sect... was already a lost cause. We could only give up on it." Li Mu grimaced. "Originally, we hoped that the eastern barbarians and the three ghoul races would attack Black Voodoo Cult after taking over Illusory Demon Sect and have Black Voodoo Cult take some of the pressure. We didn't expect the eastern barbarians and the three ghoul races to ignore the Black Voodoo Cult, and directly target Flaming Sun Island."

"In my view, the eastern barbarians and the three ghoul races were planning to go for Flaming Sun Island from the start. Illusory Demon Sect was just a stepping stone," Xu Ran shouted.

"They were aiming for Flaming Sun Island?" Yu Lingwei's expression was shocked. "Flaming Sun Island and the eastern barbarians have never had any conflict, and no contact in the past. Why would they want Flaming Sun Island?"

She was not the only one confused. Many of the experts on Flaming Sun Island were confused.

Qin Lie narrowed his eyes. He exchanged a look with Xu Ran and guessed the meaning in the other's words.

Xu Ran and Tong Zhenzhen clearly had a great understanding of the Central World. Because the pair knew his true identity, they examined this matter from a deeper level of understanding.

This time, the eastern barbarian invasion was unlike any other time, and they were much stronger.

The three ghoul races had hid for a while, and managed to get the help of the eastern barbarians to recover. There had to be a secret behind a monster like Istan waking up.

Xu Ran and Tong Zhenzhen were sure there was a string connecting the eastern barbarians and the three ghoul races. And this string... should be in the hands of a force from the Central World.

"Qin Lie! Is he the Corpse Progenitor?!"

At this time, Miao Fengtian who had resisted speaking all this time couldn't control himself and shouted.

Everyone turned to look at the ancient corpse floating above Qin Lie's head.

They were all curious what had occurred to Qin Lie in the chaotic streams of space.

"Yes, he is." Qin Lie nodded and admitted. He said, "In the chaotic streams of space, I found another Graveyard of Gods, and the Corpse Progenitor was there."

"Another Graveyard of Gods?" Everyone was shocked.

"Yes." He casually responded and then looked towards the remains of the Corpse Progenitor.

When his eyes landed on the Corpse Progenitor, countless lines came from the eyes of the Corpse Progenitor.

Those lines flashed like tiny bolts of lightning intersecting, like a spiderweb that contained the rules of the universe and restrained the Corpse Progenitor.

At the same time, Qin Lie felt something strange.

—He suddenly felt that he could control the remains of the Corpse Progenitor!

"I understand!" His eyes suddenly lit up.

In the past, the remains of the Blood Progenitor had been sucked in by the Soul Suppressing Orb and refined with secret arts. The Soul Suppressing Orb had added many ancient diagrams and wards.

Today, if he wanted to control Xue Li, he could easily do it.

This was because plex and mysterious ancient diagrams covered the seven-level Soul Altar inside the body of the Blood Progenitor.

Those ancient diagrams controlled the body and Soul Altar of the Blood Progenitor.

He realized when he saw the dense lines from inside the Corpse Progenitor's eyes that the Soul Suppressing Orb had used the same secret art to create countless wards and boundaries on this corpse as well.

When he came here, the remains of the Corpse Progenitor automatically floated up because Miao Fengtian cultivated the pure inheritance of the Corpse Progenitor and had many Corpse Demons stationed there.

"Could you, could you..."

Miao Fengtian's body shook as he looked unblinkingly at Qin Lie. He stammered but could not say what he thought.

"You want him?" Qin Lie narrowed his eyes.

"No, no." Miao Fengtian shook his head, his expression embarrassed. He said, "I just... just want a more profound inheritance. You know that the corpse power I cultivate es from a human skin scroll, it... is not very plete." He smiled anxiously.

"I can give you the remains of the Corpse Progenitor." Qin Lie grinned with slight maliciousness and said, "You can use whatever you want to search for the corpse inheritance from his body, you can refine him into an even more powerful Corpse Demon, you can even... assimilate his Soul Altar like Xue Li."

When the words were said, Miao Fengtian shook. He looked at Qin Lie, unable to speak for a long moment.

Li Mu, Tang Beidou, and the others were also surprised.

"How many levels does the Corpse Progenitor's Soul Altar have?" Miao Fengtian asked in a trembling voice.

Qin Lie sent a wisp of his soul into the mind of the Corpse Progenitor.

A seven-level Soul Altar made out of stark white bones floated in the ocean of corpse energy. The mysterious spirit lines on the seven-level Soul Altar connected to his bloodline were unusually evident.

When he looked closely, he could see the flashing divine characters in the blood lines. Those divine characters represented the special runes of the God Race, the Silver Streak Heavenly Snake, and the Spirits of Void and Chaos.

He immediately felt confident.

"Seven levels, just like the Blood Progenitor, a seven-level Soul Altar." Qin Lie snickered. "You are a poor cultivator, you may not be able to create a seven-level Soul Altar. Seven-level Soul Altar experts… they are early Genesis Realm experts that can control entire domains! If you can prehend the mysteries of the seven-level Soul Altar, you will be able to truly use the full power of the Corpse Progenitor. The Miao Family... at least, they could bee a sub rank one Gold rank force."

"I, I..."

In this moment, the demon-like Miao Fengtian seemed to lose his soul.

"The price you need to pay is forever being under the mand of this boy, unable to ever rebel." Jiang Zhuzhe came over and said meaningfully, "Consider it carefully."

"Yes," Qin Lie said calmly.

At this time, everyone became silent as they thought deeply.

They all knew just how great a temptation the Corpse Progenitor was to Miao Fengtian. Due to Miao Fengtian's talent, he might never reach the Void Realm in his lifetime, and would be unable to create the fourth level of his Soul Altar.

Even if he had extraordinary talent, would the Miao Family... have enough wealth to gather the rare spirit materials needed to create his Soul Altar?

A seven-level Soul Altar, early stage of the Genesis Realm. Even in Central World, such a person would be the ruler of a region, and undefeatable in many realms.

Even if the God Race invaded in the future, a seven-level Soul Altar expert had the power to search for a domain for their family and give their family a safe environment.

And the price was to lose one's freedom and be forever manded by one person.

Everyone asked themselves, if they encountered such an opportunity, what would they choose?

"I, I'm willing to give up everything I have now, and assimilate my soul to the body of the progenitor."

After a long time, under everyone's burning gaze, Miao Fengtian took a deep breath and decided.

"Alright!" Qin Lie grinned and said, "Starting today, the remains of the Corpse Progenitor belong to you."

You are reading Spirit Realm Chapter 1009: Miao Fengtian's Choice on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.