Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1183: Unusual Breakthrough from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1183: Unusual Breakthrough

Qin Shan's letter did not have much content.

Lowering his head, Qin Lie skimmed through it and understood the general thought behind it.

Because he had to forge some Divine Grade artifacts, Qin Shan could not leave Oldenwarm Realm, and had to stay behind to control the bigger picture.

Qin Hao was in seclusion and attempting to break through

Many of the twelve vassal forces had opinions about him due to past matters and objected to his return.

Qin Shan hoped that he could persuade Gan Feipeng and the others.

Qin Shan was also surprised about the Ji Family willing to ally with the Qin Family and Sky Mender Palace, and said that this was the testament to Qin Lie’s abilities.

He did not say much about other things, only that they would discuss them when they met in the future.

Putting the letter away, Qin Lie grinned and looked at the group. "Uncle, seniors, how am I supposed to make everyone believe I will not bring you any harm?"

When he said this, everyone stilled.

They came this time to see if Qin Lie, three hundred years later, was really different.

In terms of cultivation, the present Qin Lie was much stronger.

But what they really wanted to see was Qin Lie's maturation in mind and experience. However... this could not be seen in a short amount of time.

Also, Qin Lie did not know how to prove himself.

"Actually, if everyone goes to the Frost Desolation Abyss, you will understand him easily through the people around him," Ji Yao suddenly said.

Everyone's eyes lit up.

The best way to understand someone was through the people around them.

"Tingyu, take them to the Frost Desolation Abyss," said Qin Lie, turning his head.

Song Tingyu smiled brightly and turned around. She said, "Seniors, please follow me."

Gan Feipeng and the others as well as the people from Sky Mender Palace stared at Qin Lie for a while and then left with Song Tingyu.

Only Chen Lin, Miao Yizi, and the members of the Ji Family who had already been inside remained.

"Young master, do not be offended. They... suffered such great losses back then. It’s only natural for them to be cautious this time around," Chen Lin said coolly.

"The twelve forces lost at least two thirds of their experts back then. If the Qin Family had not been prepared, and discovered many unknown realms by that time, they may not have been able to survive in outer space." Miao Yizi’s expression was cold as she said neutrally, "pared to three hundred years ago, the Qin Family still has no real advantage over their foes. If anything happens, they will go down with Qin Family. If they suffer any losses, Qin Family will be finished, and so will they."

“Aunt Miao, you... saw my grandfather?" Qin Lie said in surprise.

"Shut up!" Miao Yizi's body shook. She bit her lips, clearly excited and said, "Since you did that thing, I do not allow you to call me this!"

Qin Lie was silent for a moment. He nodded and said, "Oh. I see."

"Junior sister, go to the Abyss as well," Chen Lin urged.

Miao Yizi snorted coldly. She did not stay and proudly walked away from Qin Lie.

"Actually, she was very concerned about you in the past. However... her methods were a little off," Chen Lin indifferently stated.

Qin Lie grimaced, shook his head and did not say anything.

"Qin Lie, when can we enter the Abyss in large numbers?" Ji Yao walked forward with a smile. "Sky Mender Palace and your Qin Family all have doubts and do not dare to recklessly enter. The Ji Family is different. Even if they do not believe you, the Ji Family does! How about that? If we go first, we can give you thirty percent of all the Abyss Devil meat we obtain."

Unlike the hesitating Qin Family and Sky Mender Palace, the Ji Family had prepared to enter the Abyss as soon as possible since their last excursion..

They were very eager to go.

Because at that moment, the races of Boluo Realm and Nether Realm, the Asura Race and the forces of the Land of Chaos had been fighting in the Abyss for a long time.

—The Ji Family was worried that these forces had already gotten all the good stuff.

"You think that it is easy over there?" Qin Lie said sarcastically.

"What? Is it very hard?" Ji Yao said, unconcerned.

"Over at Frost Desolation Abyss, right now, no forces have reaped great benefits," Qin Lie said.

"Is it really so difficult?" Ji Yao's expression turned serious.

"You might as well think about Abyss Devils as God Race clansmen," Qin Lie said.

"God Race..."

Many members of the Ji Family frowned after they heard this.

"Boom!"

At this time, Qin Lie's aura suddenly rose. A pillar of light suddenly rose into the sky, unable to be suppressed.

Within that pillar of light, there were icy crystals, lightning, thunder, ripples of geomagnetic field and waves of bloody energy.

Qin Lie's eyes shone with rays of unusual light after the pillar of light rose into the air.

The Ji Family members and Chen Lin all showed wonder in their eyes.

They could see that Qin Lie's change came from his uncontrollable cultivation which was going to breakthrough despite Qin Lie's suppression.

"It is not good to suppress yourself,” Chen Lin said easily.

Qin Lie nodded gently.

In the next moment, snakes of fire shot out of his eyes, nose, ears, and mouth.

A breakthrough in the Nirvana Realm was cleansing and refinement of the soul with Nirvana Fire. The flames that Qin Lie had used to refine his Soul Lake and True Soul were the inextinguishable flames of his bloodline.

This was clearly very different from ordinary human martial practitioners.

His mind sank into his sea of consciousness. He clearly saw that his True Soul, Soul Lake, and consciousness seemed to be burning so fiercely he was slightly terrified.

In this burning soul space, lightning flashed and thunder roared. Runes of the God Race, Ancient Beast Race, Spirits of Void and Chaos, Eight-eyed Demon Spirit, and the Abyss Devils were floating about like stars in sequence, rising and falling like a tide, mysteriously and constantly changing.

In this moment, his mind seemed to have bee the most mysterious world, the manifestation of the laws of the world.

"Hm!"

Chen Lin's expression changed. Many miniscule spatial cracks appeared in his eyes as though he suddenly felt something.

Even Miao Yizi who was moving towards the Frost Desolation Abyss through the white bone sacrificial altar suddenly stopped.

She walked back.

Just like Chen Lin, her gaze landed on Qin Lie, her expression shocked.

From the unusual vibrations ing from Qin Lie, she and Chen Lin felt an almost unusual law of space.

At this moment, many members of the Ji Family all had shocked expressions.

They looked dazedly at Qin Lie.

Looking at Qin Lie, they could almost see the secrets hidden behind their spirit arts.

It seemed that Qin Lie, in the midst of his breakthrough, carried an aura of the laws of the world.

You are reading Spirit Realm Chapter 1183: Unusual Breakthrough on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Blade Over Magic cover
Same genre

Blade Over Magic

BjOmonobi4986 ·Fantasy

XanderwashailedasTheSwordmasteronearth.Whenitcametoblades,heheldnoequal.Itdidn'tmaterwhatcategoryorhowexperiencedhisopponentwas.Hewasjustbetter,and...

Lord of the Truth cover
Trending now

Lord of the Truth

TruthTeller ·Action

RobinBurtonisayoungmanwhogrowwitheverythinganyonecanhopefor,immensetalentforcultivation,sharpmind,awealthyfamilythatwillstopatnothingtoprotectandnu...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.