Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1306: Giant Lizard from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1306: Giant Lizard

In the dark and boundless space, two figures flew rapidly toward Kunhuan Domain.

Miao Yizi, dressed in white, sat on top of the six-level Soul Altar, her narrowed eyes and cold.

Rays of bright light flashed by her and shined on her face, giving it a bright gleam.

However, the aura she gave off seemed to always carry threads of cold that made it difficult for people to approach her.

Qin Lie did not change into the Soul Beast and kept his true appearance. But even so, his speed was not slower than Miao Yizi.

He glanced at Miao Yizi, his green eyes flashing.

"Strange woman..." he thought inside.

After returning to Boluo Realm from the Frost Desolation Abyss, he and Miao Yizi crossed Boluo Realm's spatial crystal barrier and stepped into the endless void.

Along the way, Miao Yizi stayed on her six-level Soul Altar, leading the way without a word.

He had originally wanted to ask about Kunhuan Domain. But seeing Miao Yizi's cold attitude, he remained silent.

Not a word was uttered during their trip.

Miao Yizi was the one who raised the idea of leading him to Kunhuan Domain but she still refused to make a sound. This left Qin Lie speechless.

Even so, he perceptively remained silent.

Some time later, Miao Yizi suddenly opened her eyes and said, "We once fought here."

Qin Lie stilled and then looked around. He then found this area was where he, Teng Yuan, and Nivitt had attacked Miao Yizi.

However, when he and Miao Yizi fought that time, he had used the true appearance of the Soul Beast.

Miao Yizi's words caused Qin Lie to suddenly realize that his true appearance taken by the Soul Beast had been seen through by Miao Yizi.

Miao Yizi twisted her mouth and said coldly, "That time, if I had not fled into the chaotic streams of space, you would have killed me.. How could I not remember the presence of the Soul Beast?"

Not waiting for his answer, Miao Yizi said, "And that white bone scythe. I took it into my private realm and studied it a long time. I have a deep impression of the presence of that scythe."

Qin Lie's expression did not change and he said, "At the time, I did not know who you were. I also did not remember what had happened three hundred years ago."

"You really did not remember?" Miao Yizi snorted.

Qin Lie shook his head with a calm expression. "I did not."

Miao Yizi's sharp gaze sliced at him like a blade. She then took a deep breath and seemed to calm down. She said, "Last time, if you knew who I was, would you still aim to kill me?"

"That time, if you entered Boluo Realm, would you truly have helped Lunar Temple and Sun Palace create the realm entrance?" Qin Lie asked in response.

Miao Yizi's brow furrowed. She seemed to think intently and then said, "I do not know."

Qin Lie grinned and said, "Then neither do I."

"What do you mean?" Miao Yizi had an angry expression.

Qin Lie narrowed his eyes and said, "Even if I remembered who you were, if you insisted on helping Lunar Temple and Sun Palace create the realm entrance to Boluo Realm and led the six factions over, I would still have stopped you at any cost."

"Including killing me?"

"Yes."

"Don't you know I am your elder? Don’t you know what you called me back then? You dare to kill me?!" Miao Yizi scolded angrily.

Qin Lie's face was serene. "No matter who you are, if you attempt to destroy everything I’ve built in Boluo Realm, I will not hesitate in killing you."

Miao Yizi's gaze changed at his words and he became silent.

A long time later, she slowly nodded and said, "You’re different. You and him from three centuries are pletely different in conduct. I’d even suspect you were two different people if not for your God Race bloodline.."

Qin Lie smiled and did not answer.

Two souls having resided in his body was his greatest secret. He had never shared this secret.

Therefore, he didn’t explain anything to Miao Yizi.

The duo fell into silence yet again.

After a while, an area of floating meteors appeared ahead.

Qin Lie looked from afar and knew there was a realm entrance hiding within the meteor area.

Back then, the Lizard and Dragonman Races’ clansmen came out of there and trapped Miao Yizi.

However, in the end, he killed them.

And then, they revisited this place during their trip to Kunhuan Domain.

"Hm..."

From afar, Qin Lie's Soul Beast avatar felt clear soul vibrations from the area of meteors.

"What is it?" Miao Yizi asked.

"Do you remember this meteor group?"

"Yes, I remember that I was trapped there by the Lizard and Dragonman Races before."

"There are many foreign races active there."

"Oh? Shall we go and see then?"

"Yes."

After a brief exchange they concealed their presences and slowly sneaked towards the meteor group.

Miao Yizi's six-level Soul Altar's light was almost pletely concealed. The unusual spatial vibrations she gave off disappeared pletely.

Qin Lie used the Dark Soul latent ability. Unless he encountered Genesis Realm experts, he could not be detected.

The two did not attract the attention of the foreign races on the way. They quickly went deep into the meteor swam to the realm entrance of the Lizard Race.

Many Lizard Race clansmen were kneeling on a giant meteor as though they were paying respect.

That strange realm entrance was in front of them. The Lizard Race clansmen who had arrived first seemed to be waiting for something.

Qin Lie and Miao Yizi hid and looked curiously at the realm entrance, amazed inside.

They wanted to know who was going to e through.

Soon after, earth-shaking roars came out of the realm entrance.

An enormous soul consciousness seemed to pass through the realm entrance and arrive first

The Lizard Race clansmen felt the familiar soul presence and became excited, shouting in the Lizard Race language.

Behind a meteor, Miao Yizi's expression changed and she reacted, saying, "It might be the giant lizard ing over!"

"Giant lizard? The progenitor of the Lizard Race?" Qin Lie was shocked.

When he had been in the Ruined Lands, he had learned about the Lizard and Dragonman Races. He knew the ancestor of the Lizard Race was an enormous lizard with a bloodline related to the Giant Dragon Race.

That giant lizard gradually produced the Lizard Race through reproducing with other weak races.

Supposedly, that giant lizard had been hiding in the realm of the Lizard Race and had a powerful bloodline stronger than the Genesis Realm.

"Why did he suddenly e from the Lizard Realm?" Qin Lie was very curious.

You are reading Spirit Realm Chapter 1306: Giant Lizard on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Supreme Vision Master cover
Same genre

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.