Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1320: Corpse Refining Secret Art from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1320: Corpse Refining Secret Art

Qin Lie shuddered a little before asking, “Are we really going to return to the Central World so brazenly?”

“Originally, there were a lot of races and forces who were close to us. However, they’ve slowly cut ties with us because they lacked confidence in our strength and were worried that we might be destroyed by the six great forces,” Chen Lin said calmly. “We believe that we’ve observed these fools enough to lay judgment on them.”

“On the other hand, there were some neutral forces who couldn’t decide if they should support us because they didn’t have a gauge on our true strength. They think we’re lacking, so to speak.”

“That is why the old master believes that it is time we show a bit of our strength and give them a boost of confidence.”

“As for our former ‘allies’ who hesitated even though we’ve given them aid in the past, we’ll remove them from our forces as quickly as we can.”

Qin Lie nodded. “I understand now.”

Chen Lin smiled slightly. “Old Dan and I will guard your Soul Beast avatar in the meantime, so you don’t have to worry. Also, you don’t have to worry about Boluo Realm once Kunhuan Domain and the Lizard Race’s pletely fall under our control.”

“Understood,” Qin Lie replied.

“Oh right, have you e into contact with the Blaze Family in the past?” Chen Lin asked suddenly.

Qin Lie shot a glance at Miao Yizi and Dan Yuanqing.

Chen Lin said calmly, “My junior sister and your Uncle Dan have our plete trust. There’s nothing you cannot discuss in their presence.”

“Mn.” After pondering for a moment, Qin Lie started explaining how he came to encounter Gan Xing and his teammates at Extreme Flame Abyss, how he was invited to explore the Origin World, and how the fact that he possessed the Flesh Filling Tombstone was ultimately exposed. He didn’t hide anything at all.

Chen Lin listened carefully to every word. He never interrupted or asked a question.

When Qin Lie was finally done telling his story, Chen Lin spent a moment thinking before he finally spoke up, “I will inform the old master about this. He probably has other plans in place in regards to the Blaze Family.”

Astonished, Qin Lie asked, “Did grandfather have dealings with the Blaze Family too?”

Chen Lin hesitated for a moment before explaining, “Yes, the old master has spoken to them in the past. However… it’s not quite as you imagine it to be. Strictly speaking, these people are no longer considered to be part of the Blaze Family, nor are they admitted by the God Race itself.”

Surprised, realization suddenly struck Qin Lie. “Were they the ones that had gone missing twenty thousand years ago?”

“You are truly a smart man, young master.” Chen Lin smiled.

Qin Lie was about to shoot more questions at him, but the latter waved his hands and said, “Alright, if you have any further questions, you should take them to the old master yourself. To be honest, I don’t know the details very well and I won’t be able to give you satisfactory answers. I believe it won’t be long before you reunite with the old master once more.”

“Okay.” Qin Lie nodded.

After that, Chen Lin, Dan Yuanqing and Qin Lie decided to leave the Lizard Race’s realm.

Miao Yizi asked to follow him when she heard they he was heading to Frost Desolation Abyss. He used Curtis as a soul beacon to create a star door.

His Soul Beast avatar remained behind so that it could refine the Lizard Progenitor into a soul slave.

As for his true self, he passed through the star door with Miao Yizi and entered Frost Desolation Abyss, appearing once again between the ice pillars.

“Master!”

Curtis, the Asura soul slaves and Miao Fengtian immediately saluted him respectfully when he appeared.

“Qin Lie, are you done refining that Origin Crystal already?” Salleh of the Bone Race turned to look at him with curious eyes.

“You can say that.” He smiled at Salleh before asking curiously, “Speaking of which, are you… planning to stay for a while, Salleh?”

He’d already been told through Miao Fengtian and Curtis during refining of the Origin Crystal that Salleh didn’t feel like leaving just yet.

Salleh and Miao Fengtian had spent days and nights discussing how to refine Corpse Demons while he was busy constructing his Soul Altar in the Origin World.

Miao Fengtian had acquired the Corpse Progenitor’s full inheritance, and he had his own understanding in the art of refining corpses.

Similarly, the Bone Race clansmen were experts in refining corpses.

Both Miao Fengtian and Salleh felt very enlightened during their exchange. Naturally, Salleh found even less reason to leave in a hurry.

In return, Salleh had taught Miao Fengtian many secret arts that the Bone Race normally didn’t pass to outsiders. As a result, his understanding of the way of corpse refinement grew deeper and deeper.

That was why Miao Fengtian was perfectly content to keep Salleh around.

“You’re right. I’m really not in a hurry to leave this place.” Salleh smacked his lips once before continuing, “I’ve learned many things during my stay here, especially in regards to the way of refining Abyss Devil corpses. We’ve never truly been able to preserve their bloodline power after turning them into Corpse Demons. Thankfully, your men here are very well-informed on this matter.”

“Preserving an Abyss Devil’s bloodline power…” Qin Lie’s eyes glittered when he said this.

It was at this moment Miao Fengtian sent him a soul message, saying, “The Bone Race’s understanding of the power of blood seems to be inferior to us and I think it’s because we have the Blood Progenitor. At the very least, our understanding of most races’ bloodlines is deeper than theirs.”

“That being said, the Bone Race is a lot more skilful than we are when it es to refining corpses. This Salleh is a great boon to me, and I’m now capable of using the fourth level of the Corpse Progenitor’s Soul Altar. My understanding of the Corpse Progenitor’s inheritance is growing by leaps and bounds as well.”

“In the past, I could only refine rank eight Abyss Devils into Corpse Demons. But after interacting with Salleh, I believe that I can refine even a rank nine Lord of the Abyss into a Corpse Demon while still preserving its bat instincts—assuming that its soul is pletely exterminated.”

Miao Fengtian told Qin Lie his thoughts and everything that had happened lately in detail.

Qin Lie gave him a secret nod before smiling at Salleh. “You may stay here for as long as you wish, Salleh.”

“That’s great.” Salleh was happy to hear this.

“How are the Nether Realm denizens doing? Most have left, haven’t they?” Qin Lie asked.

“There is a small number that hasn’t left yet,” Curtis answered. “Also, a Ghost Eye clansman called La Pu requested that you visit him after you’ve returned.”

“La Pu…” Qin Lie raised an eyebrow before nodding thoughtfully. “In that case, I shall visit him right away.”

Miao Yizi hadn’t spoken a word ever since she arrived at the Frost Desolation Abyss. Seeing that Qin Lie was leaving to handle some business, she left on her own and went outside.

“Sky Mender Palace and the person in charge of the Ji Family wishes to see you urgently as well,” Curtis added.

“Got it.” Qin Lie left just like that.

Before this, he had always visited the Frost Desolation Abyss through his Soul Beast avatar. He was cautious even then.

It was because Enos’s father, a rank ten Great Lord of the Abyss had left a soul imprint inside his true body during his last visit.

The reason Enos was able to find him even after he had entered the Extreme Flame Abyss was all because of that soul imprint.

He had no choice but to meet Ji Yao, Teng Yuan and the others at Boluo Realm because of that soul imprint.

He was worried that Enos’s father would sense him and capture him the second he entered the Frost Desolation Abyss in his main body.

However, he was able to eliminate that soul imprint pletely while he was refining the Origin Crystal in the Origin World.

That was why he no longer needed to worry about being detected by Enos’s father.

That was why he dared to enter the Frost Desolation Abyss in his own body.

“Aunt Miao, can you please meet with the Ji Family and Sky Mender Palace and tell them Boluo Realm is now safe? I won’t be long.” Qin Lie asked after leaving Miao Fengtian’s corpse refinement grounds.

“Oh.” Miao Yizi nodded once before vanishing before his eyes.

Qin Lie headed to the Nether Realm denizens’ former homes.

Ever since the Nether Realm denizens learned that the abyss devil energy in the Abyss was far richer than either Nether Realm’s or Nether Continent’s, swathes of them rushed into Frost Desolation Abyss.

Nearly everyone except those who were so weak that they couldn’t even live in the Frost Desolation Abyss had made the trip.

But now that the Devil Monarch of Nine Hells Purgatory had personally opened the way to his home for them, they all went into Nine Hells Purgatory.

As a result, there were only a few Nether Realm denizens left in the Frost Desolation Abyss.

La Pu was one of them.

You are reading Spirit Realm Chapter 1320: Corpse Refining Secret Art on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

MILF Paradise System cover
Same genre

MILF Paradise System

BeingOtaku ·Fantasy

[Warning:MatureContentR-18]LotsofMelons.OnlyNTRNetori-NoNetorare.Alexwasnineteen,acollegestudent,andapparentlytheuniversedecidedtocursehim…withasys...

My Arms Can Turn into Blades cover
Same genre

My Arms Can Turn into Blades

Ode ·Fantasy

ChenLuSifindsastrangestoneandmeetsastrangegirlduringhistombsweeping.Afterthegirlslasheshimwithasword,hefindsthathecouldn'tcontrolhiswholebodybuthis...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.