Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.

Spirit Realm Chapter 1322: Ruckus

Novel: Spirit Realm Author: Ni Cang Tian Updated:
Font Size
18px
Now reading: Chapter 1322: Ruckus from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1322: Ruckus

Both the demon dragon Barett and the Vermillion Bird Tong Yan threw a drop of their refined blood at Qin Lie.

The two blood drops were about as big as a grape. They were shiny, and they dragged two tails of light behind them.

The blood droplets stopped without warning just as they were about to hit Qin Lie. Then, they rotated where they hovered while emanating a rich scent of blood.

“Thank you.”

Qin Lie produced two exquisite-looking porcelain bottles and stored the refined blood inside after thanking them. Then, he put everything back into his spatial ring once more.

Naturally, he wasn’t going to absorb the refined blood right in front of Barett and Tong Yan.

“Are you planning to give La Pu our refined blood or something?” Barett asked boisterously.

The Rank Nine Vermillion Bird thought the same as well.

It was no secret that La Pu of the Ghost Eye Race was researching everyone’s bloodline.

In fact, he and his apprentices were the only ones who insisted on staying behind even though most of the denizens of Nether Realm had gone with Ling Yushi into Nine Hells Purgatory.

Both Barett and Tong Yan knew that Qin Lie was the reason La Pu chose to stay behind.

Qin Lie had walked over from La Pu’s camp. Obviously, La Pu had to be the reason Qin Lie requested a drop of refined blood from them.

“Mn, that’s right.” Qin Lie smiled before asking, “Say, have you seen Teng Yuan and Banderas?”

“They’re still fighting the Abyss Devils of the Frost Desolation Abyss.” Tong Yan replied.

“Are you adapting well to the Abyss?” Qin Lie asked curiously.

“We’re doing okay.” Tong Yan took her time to consider her words seriously before replying, “Unlike the human race, we’re not very reliant on world spirit energy. In fact, we can even increase our bloodline power by consuming Abyss Devils’ flesh. The more refined flesh and blood energy the being we consume had, the more we benefit from it.”

“Beings like us mostly rely on increasing our bloodline power to evolve to the next level,” Barett interjected. “The God Race is the same. A long time ago, when the God Race invaded Spirit Realm, they thought of our flesh as the best source of energy.”

“I see. They all eat flesh to increase their strength…” Qin Lie muttered to himself.

“That is how it has always been.” Tong Yan shot him a confused look before saying, “Back when the Dragon Race and Ancient Beast Race were strong, and the human race was weak, we used to consume humans as food as well. In fact, we used to slaughter tens of thousands of humans as sacrifices to our ancestors back then.”

Qin Lie’s expression changed.

“Times have changed though.” Tong Yan continued, “Today, the human race is stronger than us. Not only have they dominated the Central World, they’re slowly but surely stretching their influence into the realms of other races. I heard that a lot of humans fed their descendants Ancient Beast Race captives so that they would grow strong and powerful.”

“In short, it’s something any race would do to another race when they bee the strong.” Barett concluded.

Qin Lie shuddered as enlightenment hit him.

Earlier, he felt a little queasy when La Pu had informed him of the way to improve the Perfect Blood.

He had found it difficult to accept that he had to absorb bloodlines from powerful races to speed up his cultivation.

After all, the method La Pu pointed out for him felt no different from the way Jiang Zhuzhe and his Blood Drinkers cultivated; cultivation through the consumption of blood.

In the past, he had found Jiang Zhuzhe’s way of cultivation’s disagreeable.

However, judging from both La Pu’s research and his own understanding of his bloodline, La Pu’s suggestion was without a doubt the best way to evolve his strength.

He would have to prey on powerful bloodlines from other races just like Jiang Zhuzhe’s Blood Drinkers if he wished to grow stronger.

Thanks to Barett and Tong Yan’s explanations, the final doubt in his heart was pletely dispelled.

“I understand.” He sucked in a deep breath before smiling at them. “You don’t need to worry about Boluo Realm. For now, it’s impossible for the six great forces to invade it.”

“That is good news.” Tong Yan nodded slowly. “We just need a little bit more time to ascend to rank ten. Once we succeed, we’ll have nothing to fear from the six great forces.”

“I don’t think it’ll take much longer!” Barett said confidently.

“I’m sure that you’ll ascend to rank ten in no time.” After that, he told them he needed to meet with the Ji Family and Sky Mender Palace urgently before excusing himself. Then, he left Boluo Realm’s camp.

“Swoosh!”

A flash of lightning later, Qin Lie suddenly appeared right between Ji Yao, Hua Anyang, Hunback Ba and the rest of the Void Realm experts.

Miao Yizi had arrived before him and explained the situation at Kunhuan Domain and the Lizard Race homeworld to Ji Yao and Hua Anyang.

“What’s the situation?” Qin Lie asked.

“The six golden rank forces of the Central World have summoned the chiefs of all races for a meeting! They wish to take out the Qin Family because the Qin Family is supposedly in cahoots with the God Race! The chiefs of the Dragon Race, the Ancient Beast Race, the Asura Race, the Sea Race and more have all agreed to attend the meeting.”

Ji Yao added seriously, “The Ji Family and Sky Mender Palace have received the same invitation as well. They want us to visit Ninth Heaven on the day of the meeting.”

Qin Lie’s expression changed drastically when he heard this. He yelled, “They’re calling for every race to fight the Qin Family?”

“From what I gather, a lot of chiefs have agreed to attend the meeting in person.” Ji Yao looked bitter when he said this, “In fact, the Dragon Race, the Asura Race and the Sea Race have declared that they will join forces with the six great forces and eliminate the Qin Family before the God Race arrives.”

Hua Anyang added, “Although the rest of the chiefs haven’t declared their stances yet, they all agreed to take this matter seriously and attend the meeting at Ninth Heaven.”

Qin Lie asked seriously, “What does the Qin Family have to say about this?”

The plump man Gan Feipeng straightened his spine before announcing solemnly, “Your father has declared that he would visit Ninth Heaven in person on the day of the meeting!”

“He’ll be arriving in person?” Qin Lie looked shocked.

Ji Yao shook his head and said, “I have no idea what he’s thinking. The Genesis Realm experts of the six great forces and the rank ten bloodline experts of the Dragon Race and Asura Race will definitely try their absolute best to kill him. Three hundred years ago, his Soul Altar was destroyed precisely because he was vastly outnumbered. It doesn’t look like he’s learned his lesson even though three hundred years have passed.”

“My father will be visiting Ninth Heaven in person as well.” Hua Anyang suddenly said.

“I know. Even my old master has declared that he would be attending the meeting. I just, I just think that it’s an unwise decision. Ninth Heaven is the six great forces’ domain after all.” Ji Yao sighed.

“Nothing stays the same forever.” Hua Anyang said in a heavy voice.

You are reading Spirit Realm Chapter 1322: Ruckus on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Supreme Vision Master cover
Same genre

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

Timeless Assassin cover
Trending now

Timeless Assassin

RajShah7152 ·Action

Leoawakensinaworldhedoesn’trecognize,withnomemoryofwhoheisorwhyhe’sthere.Allheknowsisthatsurvivalisn’tjustanecessity—it’shisonlychancetouncoverthet...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.