Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1678: The Six Main Territories! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Frost Desolation Abyss.

Jiang An and Xue Li were standing together at Miao Fengtian’s corpse refinement ground.

The three of them had been connected to Qin Lie by the soul for a long time now, and their current bodies and Soul Altars used to belong to the Corpse Progenitor, the Blood Progenitor, and the Voodoo Progenitor.

The Three Progenitors had been refined by the Soul Suppressing Orb and imprinted with Qin Lie’s mark before they became one with their successors.

Therefore, it wouldn’t be wrong to call them Qin Lie’s subordinates.

Jiang An and Xue Li had e searching for Miao Fengtian because they had been feeling restless as of late.

They had a feeling that something big was about to happen…

“The Vermillion Bird Realm is missing, master’s real self has disappeared some time ago, and his Dark Soul Beast avatar has gone to the purgatory with Dawson and the Great Lords of the Abyss.”

Miao Fengtian said seriously, “I also received news that the eight god corpses have just vanished from Boluo Realm due to some unknown power.”

“Did something terrible happen to Qin Lie? Will we be dragged into it?” Xue Li asked with a frown.

“Spirit Realm has been plagued with misfortunes lately. The Genesis Realm experts of the Qin Family, the Ji Family, and Sky Mender Palace hadn’t sent any word back after they left.” Jiang An pondered for a moment before continuing, “Maybe something big is about to happen.”

The trio waited in silence, their hearts heavy. They all had a foreboding that a storm was about to befall them.

They were right.

Some time later, ripples of space suddenly appeared at the corpse refinement ground.

All three martial practitioners suddenly sensed Qin Lie’s presence, although the latter felt like he was infinitely far away from them.

“Zzzt!”

The spatial ripples quickly transformed into a whirlpool that almost looked like a star door.

The trio stared at the whirlpool in fear and shock as they subconsciously tried to move away from it.

However, a strange power that seemed to appear from their very soul urged them to step into the whirlpool instead.

“Swhoosh swhoosh swhoosh!”

All three martial practitioners were sucked into the whirlpool uncontrollably.

A series of dizzying spins later.

The dazed trio abruptly discovered that they had landed on a world whose abyss devil energy was ten times richer than in the Frost Desolation Abyss. There were countless floating islands at this place. The uneven ground looked like a giant floating continent altogether.

Further away, they could see some floating islands falling downward and embedding itself into the ground.

“Whoosh! Whoosh whoosh!”

In fact, the land they were standing on was falling toward the Flaming Sun Abyss.

“Abyss Purgatory! This must be an Abyss Purgatory! Only an Abyss Purgatory would possess such a rich amount of abyss devil energy!” Jiang An screamed. He felt like Qin Lie’s presence was everywhere.

Then, he discovered a strange form of energy was swiftly entering his Soul Altar from every direction.

“W-what an amazing amount of energy!”

Xue Li exclaimed in surprise. He also felt like his Soul Altar and body rapidly absorbing the energy of this world like a sponge.

All three martial practitioners basked in the incredible feeling.

They finally realized that this change was a boon, not a misfortune!

A tremendous boon!

“Our master has obtained yet another giant boon!” Miao Fengtian couldn’t stop himself from laughing. “In fact, this boon is so big that even we, his soul servants, are benefiting from it. To think that we’d be able to partake in a piece of the pie, however small it may be!”

“I sense it as well…” Xue Li said.

Before their arrival, they had all assumed Qin Lie was in trouble and that the whirlpool was a result of his enemy taking notice of them through the soul connection.

It was only after they arrived and felt the energy pouring into their body and soul that they realized they were wrong.

Reality was a plete opposite!

“Swhoosh!”

Far, far away, an Abyss Devil suddenly appeared after passing through what seemed like an incredible long tunnel of space and time.

He was the Abyss Devil Qin Lie had contracted, Vitas…

Vitas was operating on another Abyss level when he suddenly felt like he was being summoned. Then, he was pulled into this place without warning.

The moment he arrived, Vitas immediately recognized this place as an evolving purgatory.

“Master, it’s master’s aura! Master’s Flaming Sun Abyss is transforming into a purgatory! Anyone who’s contracted to him by the soul is benefiting from this transformation!”

Vitas was a high rank Abyss Devil, so he understood what was going on immediately. The look on his face was one of pure joy.

He carelessly selected a giant rock to sit on and started studying the transformation process with his bloodline and soul.

He knew that this was the opportunity of a lifetime.

Meanwhile, the Flaming Sun Abyss was still devouring Yellow Springs Purgatory and growing in size by the second.

The six Spirits of Void and Chaos all sensed the natural laws of the Flaming Sun Abyss while it was undergoing a transformation. Right now, it was slowly consuming and absorbing the laws of Yellows Springs Purgatory into itself.

All six of them had realized that the power of law they cultivated were growing stronger as they studied the changes in the world.

Suddenly, the six Spirits of Void and Chaos spread out to six directions and created six special domains in the inplete Flaming Sun Purgatory.

“Crackle crackle crackle! Rumble!”

Thunder cracked loudly from one corner of the Flaming Sun Abyss.

The sky there was covered in thunderous clouds, and the thunder spirit was able to convert the rich abyss devil energy of this place into pure lightning energy.

In fact, there was so much power that a lightning pool had formed in the sky.

The thunder spirit kept accumulating natural energy from the ground, one that was as big as the entire Boluo Realm.

As a result, this entire domain was filled with the power of lightning. There was also a true essence in the middle of it.

The thunder spirit was studying the true essence of lightning while it was creating a new domain in Flaming Sun Purgatory.

It had a feeling that it would ascend smoothly to the next rank right after the domain of lightning was plete.

Similar things happened everywhere else.

The other five spirits had found themselves a corner of the world as well.

They all wanted to use this opportunity of a lifetime to convert a corner of the world into their private territory using their ideas, knowledge and bloodline power. They wanted to create a small world that was best suited for them.

The fire spirit’s choice was somewhere near the Origin Sea. The Vermillion Bird Realm was within its domain as well.

The wood spirit had attached itself to the Ancient Life Tree. With the Ancient Life Tree at the center, it would create a world that was even bigger and richer in life than Ancient Beast Realm.

The six great Spirits of Void and Chaos were most attached to Qin Lie. They were also the most mysterious lifeforms of the universe.

Most of the people in Spirit Realm only knew them as destroyers who absorbed world spirit energy that was suitable to them.

However, the Spirits of Void and Chaos were also creators. If they were willing, they could convert any normal world into an extreme world where only one elemental attribute existed.

The Vermillion Bird Realm and the Ice Phoenix Realm were two such examples.

Right now, they were borrowing the power of a whole new purgatory and their connection to Qin Lie to create their own domains in the Flaming Sun Abyss. Once finished, Flaming Sun Purgatory would have six main territories.

You are reading Spirit Realm Chapter 1678: The Six Main Territories! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

I'm the Culinary God cover
Trending now

I'm the Culinary God

Greedy kitten ·Fantasy

LinXu,whoisabouttograduatefromuniversity,suddenlygetsboundtotheCookingGodsystemandhasbecometheownerofarestaurant.Totastehishandmadenoodles,customer...

Supreme Vision Master cover
Trending now

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.