Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1767: Proving Himself! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

The elders of the God Race suddenly fell silent when Qin Lie confirmed his identity to them.

While staring closely at Qin Lie with suspicion, they circulated their bloodline in secret and tried to measure his real strength through his aura and energy.

An Hao, Han Che and Lieyan Zhao weren’t speaking either. They too were staring at Qin Lie in puzzlement.

Qin Lie was like an enigma to them right now. They discovered that they couldn’t quite get an accurate measure of Qin Lie’s power.

“Wait, he walked out of Flaming Sun Purgatory…”

An Hao of the Darkness Family thought to himself before realization suddenly entered his eyes.

“Could it be?”

He shook violently before blurting in shock, “You survived the purgatory’s trial already?”

Han Che and Lieyan Zhao yelled at the same time when they heard this, “Have you bee the eighth Devil Monarch?!”

“What? The eighth Devil Monarch? Him?” A Profound Ice Family member glared at Qin Lie in disbelief. “You’re saying that a mixed-blood with the Blaze Family bloodline had bee the monarch of the Eight Purgatories? The eighth Devil Monarch?”

“How is that possible?”

“That’s just unrealistic!”

“Only a pure Abyss Devil can bee the monarch of a purgatory. He… isn’t a pure Abyss Devil, is he?”

The elders of the Profound Ice Family and the Darkness Family clearly found the patriarchs’ claim difficult to believe.

Qin Lie remained in his human form and didn’t try to activate his God Race or Abyss Devil Race bloodline. He simply smiled calmly at the elders and said nothing.

He was sure that these God Race elders would hear of the latest news of the universefrom their informers very soon.

Sometimes, the word of others was more persuasive than the truth from one’s own mouth.

As expected, it wasn’t long before a Darkness Family elder appeared from the realm entrance in a hurry.

The elder had to support himself with a cane, and he looked as wizened as a dried up corpse. However, an intimidating light had settled in his gloomy eyes.

“Brother Byron!”

All the elders bowed slightly toward the newer in respect. It was clear that this Brother Byron had seniority over them.

“Uncle!” An Hao exclaimed with a bit of surprise.

Byron was one of the most respected elders in the entire God Race!

Byron wasn’t just a senior to An Hao, he was the person he admired since young.

Earlier, he tried to invite Byron to Ice Night Realm, but the old man had turned down his request.

After hearing the elders’ attempt to persuade him to change his mind, An Hao knew that Byron was tired of their race’s infighting and had submitted to Lieyan Yuan.

But now, Byron had suddenly rushed over to Ice Night Realm. A lot of people were confused by this.

“T-that Qin Lie has walked out of Flaming Sun Purgatory!”

Byron had never seen Qin Lie at all, so he had no idea Qin Lie was right there with him. He looked at An Hao and said, “That boy actually passed the trial of the Abyss and became the eight Devil Monarch of the Purgatory! All of the Abyss Devils gathered at the entrance of Flaming Sun Purgatory had escaped after he killed two Great Lords of the Abyss, Taurus and Rathain!”

Byron sucked in a deep breath to calm himself, but it was clear that it wasn’t enough to quell his excitement. He continued, “What’s even more shocking is this: That Qin Lie later went to the Bone Race and Winged Race’s domain and slaughtered all the invading shadow beings!”

Byron stared at An Hao with wide eyes and asked, “Is that kid… really a member of our race?”

An Hao was pletely stunned.

The rest of the elders were speechless as well.

Everyone was staring at a calm-looking Qin Lie in shock.

“Why are you all quiet?” Byron asked in confusion.

“Brother, er…” A Darkness Family elder pointed at Qin Lie before replying, “He’s that guy you’re speaking of.”

Byron jumped on his feet before exclaiming, “Are you Qin Lie?”

“Greetings, senior,” Qin Lie said with a smile.

“Y-your aura…” Byron looked very puzzled.

Qin Lie let out a chuckle before igniting his Blaze Family bloodline. Fire immediately burst out of his body and turned his surroundings into a sea of flame.

From time to time, the Flame Devil King’s life crystaland the Blaze Family’s Flesh Filling Tombstone could be seen behind the flames.

Finally, he allowed his bloodline power to erupt like a bomb.

“Roar!”

Qin Lie let out a growl and grew quickly in size. In just a dozen or so seconds, he had transformed from a human into a seven thousand meters tall Great Lord of the Abyss.

The rampaging flames gushing out of his pores and the terrifying laws of fire threatened to melt down the entire Ice Night Realm.

“Qin Lie! Enough!” Han Che yelled hurriedly.

“It’s Qin Lie!”

Mia immediately identified Qin Lie when she sensed the blazing flame, flew out of an ice palace and saw the giant Abyss Devil.

Xuan Luo also walked out of another palace and identified the devilized Qin Lie immediately. Shock and defeat welled in his heart.

Many years ago, when he had fought Qin Lie at the Origin World as a representative of the Profound Ice Family, his bloodline was at the same level as Qin Lie.

Although he was a tad weaker than Qin Lie, he believed that it was because the latter had the Blaze Family’s Flesh Filling Tombstone.

Fast forward into the future, Qin Lie became the creator of the Flaming Sun Abyss and was revealed to possess the Perfect Blood.

Not long after, the young man’s name spread throughout the entire galaxy.

Xuan Luo never stopped trying to narrow the gap between him and Qin Lie.

But after seeing Qin Lie transforming into a Great Lord of the Abyss while unleashing the aura of an Abyss Devil and a God Race at the same time, the thought finally died in his heart.

He had a vague feeling that Qin Lie’s reservoir of refined flesh and blood energy had exceeded all the experts in Ice Night Realm.

This included the three patriarchs An Hao, Lieyan Zhao and Han Che!

“Oops, sorry.”

Qin Lie quickly realized his mistake and let out a apologetic chuckle. Then, he shrank back to his normal size again.

Soon, he had withdrawn all of his bloodline power except his Blaze Family bloodline.

He transformed into a Blaze Family member with red eyes, red hair and the pure aura of fire.

Byron stared blankly at Qin Lie and probed him again. He discovered that the young man’s aura was almost identical to Lieyan Zhao’s.

If he hadn’t witnessed the shocking transformation earlier, he would’ve confused Qin Lie as a pure-blooded Blaze Family bloodline warrior.

“Is this the power of the Perfect Blood? Magical, how magical!”

“That was… the true form of a real Devil Monarch just now, isn’t it?”

“So powerful! Lieyan Yuan is still stronger than him, but not by a lot!”

The Darkness Family and Profound Ice Family elders’ stances shifted quietly after Qin Lie’s display of power.

You are reading Spirit Realm Chapter 1767: Proving Himself! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Supreme Vision Master cover
Same genre

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

The Lucky Farmgirl cover
Trending now

The Lucky Farmgirl

Bamboo Rain ·Romance

TheFourthBrotherhadsquanderedhiswealththroughgambling,leavingtheirmotherinacriticalstate.Tomakemattersworse,thecreditorsevenaskedthemtosellManbaoto...

I'm the Culinary God cover
Trending now

I'm the Culinary God

Greedy kitten ·Fantasy

LinXu,whoisabouttograduatefromuniversity,suddenlygetsboundtotheCookingGodsystemandhasbecometheownerofarestaurant.Totastehishandmadenoodles,customer...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.