Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1774: Temple of Gods from Spirit Realm, a Fantasy novel by Ni Cang Tian.

After Yu Xi arrived, he saw Kuang Jue and the members of the Bloodthirst Family. His bitter expression grew.

"Kuang Jue can mand the warriors of the Bloodthirst Family to immediately kill Lieyan Zhong but he does not allow any family member to participate," An Hao cursed.

Yu Xi heard the words and his expression grew more awkward.

When Blood Emperor Li Xin came, the Light Family was not in agreement. Many elders opposed his decision and hoped that he would give up the Flesh Filling Tombstone.

The Bloodthirst Family was pletely different.

When Lieyan Zhong came and asked Kuang Jue to temporarily give up his Flesh Filling Tombstone, the members of the Bloodthirst Family were pletely infuriated.

If not for Kuang Jue, all the members of the Bloodthirst Family would have charged and killed Lieyan Zhong.

As the patriarch, Kuang Jue stated if Lieyan Zhong could win against him, he would give up the Flesh Filling Tombstone.

He did not allow the other members of the Bloodthirst Family to fight.

Due to this, his battle with Lieyan Zhong had continued until now.

An Hao and Han Che had e through from the Ice Night Realm with a spatial passageway and Qin Lie's help. They had also been ordered to not act.

He wanted to win against Lieyan Zhong with his own power under the gaze of all Bloodthirst Family members.

An Hao and the others could only wait helplessly for him to first defeat Lieyan Zhong.

Qin Lie and the eight Undying Titans could only respect Kuang Jue’s wish after Yu Xi arrived and watch, waiting for the battle’s ultimate victor.

"How are things on your side?" An Hao asked Yu Xi.

Yu Xi's face trembled unnaturally. "Fine."

"Ha, among us, you respect the old people the most. I guess your family had the most internal problems," An Hao teased.

Yu Xi snorted but didn't argue.

"Is that Qin Lie?"

"I heard he became a Devil Monarch."

"After being a Devil Monarch, is he still trustworthy?"

"Should we treat him as a member of the Blaze Family or an Abyss Devil? So strange."

“……”

The members of the Bloodthirst Family started to discuss after Qin Lie came over in the form of a Devil Monarch.

They curiously examined Qin Lie, sensing his bloodline presence as they speculated inwardly.

"Do not worry. He is a member of the Blaze Family. His primary bloodline is the Blaze Family bloodline!" Lieyan Zhao shouted.

"Lieyan Zhong, die!" Kuang Jue's shout came at this time.

Everyone's attention was attracted by Kuang Jue's shout. They gaze all landed on Kuang Jue and Lieyan Zhong.

All kinds of negative bloodthirsty presences spread with Kuang Jue as the center. The negative powers contained despair, terror, anger, fury, and all kinds of extreme emotions. A kind of mental wave spread under the power of Kuang Jue's Flesh Filling Tombstone.

In this moment, they found the screams of Great Lords of the Abyss ing from around Kuang Jue.

He immediately understood. The anger and despair of the Great Lords of the Abyss Kuang Jue and the Bloodthirst Family had killed had been refined by the Flesh Filling Tombstone.

Among them were also the death auras of many foreign races that had died at Kuang Jue's hands and had been refined by the Flesh Filling Tombstone.

The negative emotions that furiously erupted in unison helped expand Kuang Jue's presence.

Lieyan Zhong's Flame World that he formed with his bloodline collapsed after his soul was struck by the mental wave of negative emotions.

A moment later, the domain shattered and turned into mere strands of fire energy.

At this moment in Qin Lie's senses, Lieyan Zhong's bloodline and the Flame World suddenly lost contact.

Kuang Jue roared like an angry beast. He used the evil mental wave to attack Lieyan Zhong's soul.

Lieyan Zhong clearly was not up to the task.

"Zzt zzt!"

However, a spatial crack suddenly appeared as Lieyan Zhong continued to retreat.

Lieyan Zhong disappeared eeriely.

"All of you, e to the Temple of Gods."

Lieyan Yuan's voice slowly came out of the spatial crack.

"I am here!"

Kuang Jue, the patriarch of the Bloodthirst Family, was pletely red-misted. He agreed and was going to charge in.

"Do not!" An Hao hurriedly stopped him.

"Do not enter his spatial passageway!" Han Che shouted.

Kuang Jue heard their warnings and stopped just before he was about to charge into the spatial passageway.

He suddenly looked at Qin Lie.

At this time, An Hao, Lieyan Zhao, Han Che, Yu Xi and the other members of the Bloodthirst Family all looked over.

Qin Lie immediately understood. He nodded. "I will bring you to the Temple of Gods."

As he finished speaking, he used the power of the Galaxy Mirror to create another spatial rift.

"Go!"

The figures quickly entered the Temple of Gods through the spatial crack.

Inside the Temple of Gods.

Blood Emperor Li Xin, Lieyan Zhong, and the patriarch of the Evil Dragon Race were all kneeling on one knee below a tall old man in flames on the throne.

Outside the Temple of Gods were many Blaze Family warriors that obeyed Lieyan Yuan.

Other than this, the Earth Demon Race, the experts of the Three-Eyed Race, the Dragon Lion Race, and other small races were all waiting for orders outside the Temple of Gods.

If Lieyan Yuan gave an order, they would attack.

"Whoosh whoosh whoosh!"

A narrow spatial crack appeared in the Temple of Gods. Qin Lie and the others appeared.

When he entered, Qin Lie's gaze focused on the tall figure on the God King throne.

"You should greet me." Lieyan Yuan smiled slightly. The flames around him suddenly went out. His expression was benevolent and proud. "You are my grandson and you’ve reached this point in just a century. I am proud of you."

"Thank you." Qin Lie's expression was calm and said, "I came in the hope that you will e down from this position."

"This position?" Lieyan Yuan stood up and pointed at the God King throne. He said with a smile, "I am only temporarily sitting in this position for you. When I reach the ultimate realm, I will naturally give it to you and support you to bee the new God King."

"I fear at that time, Castor will have killed me," Qin Lie fired back.

Castor was able to wake up and recover to his present strength because of the secret plans of Tian Qi and this old fogey.

The stronger Castor was, the more likely it would be for Qin Lie to be taken over by Castor.

He used Castor to remind Lieyan Yuan of the role he played.

"Castor?" Lieyan Yuan laughed. shook his head and said, "From beginning to end, he is just cannon fodder. I just used Castor to stimulate you so that you could successfully bee the Devil Monarch of Flaming Sun Purgatory, and grow stronger faster."

"Now it appears, everything... is still according to my plans."

"Do not worry. Castor is just a mere stepping stone for you and me. He will not last for long."

He paused and stepped down from the God King throne. He said, "If you want to sit on this position now, I do not mind giving it to you."

You are reading Spirit Realm Chapter 1774: Temple of Gods on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Supreme Vision Master cover
Same genre

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

I'm the Culinary God cover
Trending now

I'm the Culinary God

Greedy kitten ·Fantasy

LinXu,whoisabouttograduatefromuniversity,suddenlygetsboundtotheCookingGodsystemandhasbecometheownerofarestaurant.Totastehishandmadenoodles,customer...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.