Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1780: Molten Rock Purgatory! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

After shrinking to human size and activating the power of absolute frost, Qin Lie’s veins, blood, and bones were seeping with cold energy.

“Crack crack!”

The world around him started freezing at a rapid rate.

At the same time, cold energy entered his heart swiftly through his veins.

“Sizzle!”

It immediately started fighting the gushing volcanoes inside of him.

“Swhoosh swhoosh swhoosh!”

The power of absolute frost produced countless strands of icy energy. The Profound Ice bloodline's laws and the Ice Emperor’s frost concept turned into translucent crystals and froze his heart.

Every bit of flesh, every drop of blood was quickly encased in ice.

The Molten Rock Purgatory’s shrunken mountains continued to shine with the light of the laws of fire and clash fiercely against Qin Lie’s bloodline crystals.

Qin Lie was losing flesh and blood power rapidly.

“Flesh Filling Tombstone!”

The Blaze Family’s Flesh Filling Tombstone surfaced from his chest.

“Tombstone Fusion Art!”

In an instant, Qin Lie and the Flesh Filling Tombstone merged as a constant stream of refined flesh and blood energy poured into his body.

The energy was converted into the power of absolute frost inside his blood vessels and veins.

Another surge of frost mist entered his heart and froze it pletely.

Frost crystals lined the fleshy walls of his heart pletely as it constantly discharged waves of frost energy.

The fire of the Molten Rock Monarch’s burning mountains soon died out under the growing power of frost.

Even the Molten Rock Monarch’s roars had bee intermittent.

Soon, all of the burning mountains were frozen in ice.

“Crack!”

The last of them abruptly shattered into bits of flame.

The flames were extinguished quickly after the flash. They could no longer affect Qin Lie in the slightest.

“Done…”

Qin Lie muttered to himself and withdrew the power of frost from his Abyss Devil Race heart.

“Eh!”

However, he discovered that he had been brought into Molten Rock Purgatory while he was busy clearing out the burning mountains inside his heart.

“Drip! Drip!”

The ice that covered his entire body melted slowly under to the constant heat of Molten Rock Purgatory.

Qin Lie looked toward the horizon and saw burning volcanoes everywhere. The ground was overflowing with rivers of fire.

The sky was dark red and burning constantly.

The lava on the ground looked like blood as it profilerated every corner of his vision.

The air he sniffed in was dry and unpleasant. It was tainted by a strange, sulfuric smell.

Some distance away from him, a bunch of Abyss Devils covered in burning liquid roared in unison and took to the sky.

A dozen or so Abyss Devils had appeared around him in just a short time.

Most of them were rank nine Lords of the Abyss. There were even three Great Lords of the Abyss.

“This is my Molten Rock Purgatory!”

The Molten Rock Monarch appeared behind a dark red cloud in the sky. His giant claw was still gripping the Flame Devil King's life crystal tightly.

The Molten Rock Monarch laughed sinisterly before saying, “Flaming Sun Monarch, if you agree to surrender my lord’s life crystal permanently, I will allow you to return to Flaming Sun Purgatory alive!”

“This tiny ant is the Flaming Sun Monarch?”

“What a joke!”

“He’s outsized by even our lowest ranking Abyss Devils!”

The Great Lords of Molten Rock Purgatory ridiculed Qin Lie’s human form mercilessly.

“Shred!”

Spatial rifts suddenly appeared from the sky of Molten Rock Purgatory.

In the next moment, six Devil Monarchs led by Auston charged into the purgatory furiously.

The six Devil Monarchs unleashed their destructive auras as they floated in the sky like living mountains.

“Molten Rock Monarch! Cease your single-minded endeavor!”

“You’ve pissed me off!”

“Do you want us to remove you from our ranks permanently?”

Everyone was yelling. It was clear that the Devil Monarchs were seriously angry.

“The only reason I was able to bee the Devil Monarch of Molten Rock Purgatory was thanks to my lord. Everything I have now is a gift from him,” the Molten Rock Monarch said while staring at the Devil Monarchs coldly. He let out a snort and continued. “If I can resurrect my lord back to life, I can give up even my Molten Rock Purgatory! I will take him away from this place like what Castor’s allies recently did and wait until he recovers. I can always remake Molten Rock Purgatory after he regains his full power! All of you will be burned to ash by my lord’s flames of fury!”

“So you'd best choose wisely while you still can!”

The Molten Rock Monarch’s reply was firm and unyielding.

It was clear he had made up his mind to resurrect the King of Flame Devils, no matter the cost.

To this end, he was willing to sacrifice even Molten Rock Purgatory and abandon his own creation.

Once the King of Flame Devils regained full strength, he was certain he would regain everything he had lost.

Anyone who tried to stop him then would be annihilated by the King of Flame Devils.

“This…”

The Devil Monarchs who rushed over from the abyss passageway were caught off guard.

Hesitation flashed in everyone’s eyes.

It would seem that the Molten Rock Monarch had absolute confidence in resurrecting the King of Flame Devils.

If the King of Flame Devils really escaped the purgatory and returned to full strength… could they really resist his power?

It was rumored that even the Imperial Soul Monarch was wary of the King of Flame Devils. At the very least, he hadn’t attacked the King of Flame Devils when the latter entered the ultimate realm.

The King of Flame Devils was stronger and more terrifying than even Castor.

If he truly awakened from his slumber and regained his full strength, did they really have the power to resist him?

The six Devil Monarchs had no choice but to consider the consequences.

“Transform!”

It was at this moment Qin Lie returned to his Great Lord of the Abyss form.

“You’re still not giving up?” The Molten Rock Monarch roared angrily, “This is my purgatory! You dare fight me in my own domain? You are courting death!”

“Bloodline ability, flame consumption!”

Qin Lie suddenly activated the bloodline of Spirits of Void and Chaos. A strange spatial hole appeared right in front of him.

The fire spirit flew out of his glabella and landed at the center of the hole.

“Whoosh whoosh whoosh!”

Sparks started flying off the ground, the volcanoes, and the Abyss Devils and into the hole uncontrollably.

“Rumble!”

The ground of Molten Rock Purgatory started splintering amidst the tremor.

Even the volcanoes were falling apart. It was as if something… was tearing and destroying Molten Rock Purgatory.

The lava, the liquid fire, and the flames were the elements that made up the power foundation of Molten Rock Purgatory. Without them, without its very roots, Molten Rock Purgatory was threatening to fall apart.

This was the most basic law of the Abyss.

Spirits of Void and Chaos… had the power to devour anything of their element. And Qin Lie had their bloodline as well.

Therefore, flame consumption was a bloodline ability both he and the fire spirit could use!

You are reading Spirit Realm Chapter 1780: Molten Rock Purgatory! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Supreme Vision Master cover
Same genre

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

Lord of the Truth cover
Trending now

Lord of the Truth

TruthTeller ·Action

RobinBurtonisayoungmanwhogrowwitheverythinganyonecanhopefor,immensetalentforcultivation,sharpmind,awealthyfamilythatwillstopatnothingtoprotectandnu...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.