Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1808: Ethereality! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

“You’re not the Abyss Master yet. Your bloodline is only at rank ten.” Lieyan Yuan laughed sinisterly as he spoke. “Even if you have transcended rank ten and entered the ultimate realm just like the King of Flame Devils, your body still wouldn’t be able to handle this flame!”

“In fact, no body made of flesh and blood in the universe can handle this flame!”

“Even I dare not refine it into my body despite having entered the ultimate realm.”

“But it doesn’t matter, as long as I can control it!”

The tiny fireball suddenly sped up after he was done talking.

“Rip!”

Dragging a bright tail of light behind it, the fireball flew toward Qin Lie’s chest like a fire spirit.

It was where Qin Lie’s heart resided!

Lieyan Yuan knew full well that the heart was the source of Qin Lie’s bloodline power. If it was destroyed, then Qin Lie wouldn’t be able to execute his abilities, no matter how powerful they were.

Qin Lie was no threat without his bloodline power or the Perfect Blood.

“You haven’t bee the Imperial Soul Monarch yet, and you haven’t entered the ultimate realm either. Your efforts are futile the way you are now,” Lieyan Yuan said while laughing madly.

The fist-sized fireball contained a terrific amount of fiery energy. The spatial restrictions Qin Lie had summoned earlier were burned down immediately.

Qin Lie narrowed his eyes as he watched the approaching fireball. He discovered that the layers of space he had created were crumbling swiftly.

He knew that Lieyan Yuan was telling the truth.

That tiny fireball was the world’s ultimate manifestation of fire. It could literally burn anything.

Space, flesh and blood, stars. Nothing was impossible to burn.

Not even the spatial restrictions he had created with the Galaxy Mirror were able to stop the ultimate flame’s terrible might.

He watched as his defenses crumbled, and the ultimate flame grew closer. His expression kept changing.

“Yiya, yiyayiya!”

Suddenly, the fire spirit on his shoulder sent him a soul message.

Lightning flashed across Qin Lie’s ice cold pupils.

“The Spirit of Void and Chaos bloodline!”

The bloodline crystal of the Spirits of Void and Chaos inside his Perfect Blood suddenly exploded into a spectacle of crystalline light.

Millions of rays of light surged inside Qin Lie’s bloodline like the stars and meteors of the universe.

A mysterious bloodline power appeared to his consciousness in an instant.

“Ethereality.”

Suddenly, Qin Lie’s body turned incorporeal, ethereal through a mysterious method.

He looked like a fake shadow.

Without a body, he felt as if he had turned into a ghost all of a sudden. He couldn’t even feel hot anymore.

“Sizzle!”

The ultimate flame passed through his heart to the back.

A spatial rift suddenly appeared out of nowhere and devoured the tiny fireball like the maw of an invisible Abyss Devil.

“Swhoosh!”

The Galaxy Mirror escaped Qin Lie’s grasp and slipped into the spatial rift as well.

The spatial rift immediately disappeared after he went in.

The next moment, Lieyan Yuan discovered that his connection with the fireball was severed.

“What?!” Lieyan Yuan exclaimed in shock.

He was equally versed in the laws of space. He could traverse freely between different spaces and easily swim about in the chaotic streams of space.

It was why he was confident that he could sense and regain control of his fireball, no matter where it ended up.

However, he couldn’t sense the fireball at all after it vanished into that spatial rift.

“Go!”

A flash of joy appeared on Qin Lie’s face before he tore apart space again and sent the fire spirit and the Flame Devil King’s life crystal through it.

At Flaming Sun Purgatory.

A shiny hole suddenly appeared where the Vermillion Bird Race was cultivating.

Lieyan Yuan’s ultimate flame flew out of the hole and appeared in Qin Lie’s Flaming Sun Purgatory.

The Galaxy Mirror also appeared at Flaming Sun Purgatory right behind the ultimate flame.

Even further back was the Flame Devil King’s life crystal and the fire spirit.

The Galaxy Mirror had locked down Flaming Sun Purgatory’s space and blocked of Lieyan Yuan’s soul perception.

As a result, Lieyan Yuan couldn’t recall his ultimate flame.

The masterless wisp of the ultimate form of flame floated quietly in the sky of Flaming Sun Purgatory while unleashing waves of heat that could burn everything.

Even the land of fire created by the fire spirit and the Flame Devil King’s life crystal together couldn’t withstand the energy it was releasing.

“Rumble! Rumble!”

Rows of volcanoes crumbled while spitting blazes of flames.

The domain of fire created by the fire spirit and the Flame Devil King’s life crystal was literally the ultimate realm of fire in the entire universe, and yet the arrival of the ultimate flame still ignited it like it was made of paper.

And this was after the ultimate flame had lost connection with its master, Lieyan Yuan.

It showed just how scary the ultimate flame really was!

“Boom!”

The Flame Devil King’s life crystal suddenly sank to the heart of the volcano. It was holding Flaming Sun Purgatory together with its knowledge of the laws of fire and prevented the power of the ultimate flame from destroying it immediately.

The Galaxy Mirror kept Flaming Sun Purgatory tightly sealed with all its power so that Lieyan Yuan’s soul consciousness could never enter this place.

Finally, while Lieyan Yuan’s soul consciousness was still blocked off, the most mysterious lifeform of the universe, the fire Spirit of Void and Chaos seized this moment of calm to fly into the ultimate flame.

“Swhoosh!”

The moment the fire spirit flew into the ultimate flame, its virtual body immediately exploded into a blaze of fiery light.

The light represented the laws of fire prehended by the Spirit of Void and Chaos.

The light rays scattered inside the ultimate flame seemed to be stealing its secrets while it was masterless.

Without Lieyan Yuan to control it, the ultimate flame continued to release intense ripples of fiery energy that threatened to destroy even this ultimate land of fire.

Flaming Sun Purgatory was still exploding and crumbling. It looked like it could fall apart at any moment.

It was lucky that the Flame Devil King’s life crystal was there to hold it steady as best as it could.

The Galaxy Mirror was still keeping Lieyan Yuan’s soul consciousness out of Flaming Sun Purgatory.

The two most mysterious artifacts in the universe were doing everything in their power to buy time for the fire spirit.

Bit by bit, the fire spirit analyzed the countless number of laws of fire inside the ultimate flame and stole its secrets.

“Flaming Sun Purgatory! It’s Flaming Sun Purgatory!”

Lieyan Yuan’s soul consciousness scoured through space after space until he finally found where the ultimate flame had been brought to.

But when he tried to invade Flaming Sun Purgatory, he immediately sensed that the Galaxy Mirror was blocking his soul perception.

Lieyan Yuan roared angrily like a madman. Qin Lie’s retaliation had finally caused him to lose control.

You are reading Spirit Realm Chapter 1808: Ethereality! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.