Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1327: Mass Slaughter from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Chapter 1327: Mass Slaughter

It was a huge island in the middle of a sea of deep blue. Countless stone buildings filled the surface of the island, and flying spirit artifacts that looked like seabirds occasionally flashed across its sky.

Besides that, a lot of big ships were parked on the shores of the island. There were a lot of humans on the ships and the docks, but there were plenty of Sea Race clansmen among them as well. They were transporting many precious spirit materials that could only be mined from the bottom of the sea to the island. Then, the spirit materials were carried onto flying spirit artifacts and sold on other continents.

Right now, Qin Lie and Ji Yuan were hiding inside a cloud. They both looked surprised by the Han Family’s activities on the island.

“To think that the small Han Family would bee this prosperous in just three hundred years, all thanks to the actions of a girl.” Ji Yuan sighed emotionally. “I remember that the Han Family used to be the most inconspicuous force out of all of Ninth Heaven’s vassal forces. Even the Sea Race clansmen from Blue Snake Sea used to order them around like they were servants all the time.”

Ji Yuan shook her head before continuing, “Three hundred years have passed since. Today, the Han Family had grown prosperous using Han Qian’s connections in Ninth Heaven.”

She then shot Qin Lie an odd glance before bursting into laughter. “One might say that she literally climbed to her position today on your body, didn’t she? In fact, it won’t be wrong to say that you’re the one who gifted the Han Family their prosperity today.”

Qin Lie’s face was dark. “That’s why the first thing I’m doing after returning to the Central World is extermination of the Han Family.”

“It won’t be that easy,” Ji Yuan said calmly with a smile. “Sense closely. Do you notice how many Imperishable Realm martial practitioners the Han Family has? Don’t forget to check under the sea too. According to my knowledge, the Sea Race clansmen of Blue Snake Sea have successfully raised three rank nine bloodline experts just recently.”

Her expression slowly turned serious, “The Sea Race’s bat power is average, but Blue Snake Sea is their domain. It is a place where they can unleash their bloodline powers to the absolute limit. Also, three rank nine bloodline experts are equal to three Void Realm human experts. Are you… sure you must attack the Han Family today?”

“Yes, I am,” Qin Lie replied harshly.

Ji Yuan looked surprised by his answer. She shot him a deep look before saying, “I told you all these, but you still wish to attack the Han Family? It makes me wonder what on Spirit Realm gave you your confidence.”

“You’ll know very soon.” Qin Lie snorted.

Ji Yuan nodded and stopped trying to persuade him. Instead, she advised seriously, “Your will is not mine to bent. That being said, I hope you realize that you only have an instant to eliminate the Han Family the moment you show yourself. Do not give the Sea Race experts beneath the sea the opportunity to save them.”

“If the rank nine experts of the Sea Race emerge, you will lose your chance permanently. You’ll have no choice but to escape from this place.”

“Don’t worry.” Qin Lie narrowed his eyes and replied coldly, “I will eliminate every living being on that island in just the blink of an eye. There is absolutely no chance anyone will survive this attack.”

Ji Yuan’s beautiful eyes glowed brightly when she heard this. She stared at him closely as a brilliant smile spread across her face, “What are you waiting for then?”

“I’m not,” Qin Lie said seriously.

“Zzzt!”

A bolt of lightning flew out of his pupils, and a translucent Soul Altar appeared into existence.

The Soul Altar was refined from an Origin Crystal. Lightning and thunder could be seen surging inside the second it left Qin Lie’s body.

The crystalline altar floated above Qin Lie’s head as the Sky Piercing ancient spirit diagram it had fully absorbed before appeared.

Suddenly, Qin Lie felt like he had bee one with the world. It was as if he had plete control over the power of thunder, frost and earth all around him.

“Heavenly Thunder Eradication, Thunder of the Ninth Heaven!”

“Rumble!”

Thick lightning suddenly poured down from the clouds above like a waterfall. It was as if they were lightning dragons emerging from the the Lightning Pool of the Ninth Heaven itself.

Ji Yuan looked up in shock.

The sky had been clear and cloudless, but now it was pletely covered in thunderous black clouds.

Suddenly, Ji Yuan felt like the world was about to be destroyed in an apocalyptic hail of thunder and lightning.

The strange mark on Qin Lie’s chest glowed brightly with lightning like a tiny sun. It seemed capable of controlling the thunder and lightning around it to the fullest.

The Sky Piercing ancient spirit diagram inside Qin Lie’s lightning-filled Soul Altar continued to work slowly. It seemed to be pulling thunder and lightning from every corner of the world.

In just a dozen or so seconds, the unnaturally thick lightning bolts collapsed onto the island like an angry sea.

“What’s going on?”

“What happened? Why’s the sky suddenly dark?”

“What’s with this terrifying thunder!”

The martial practitioners dressed in Han Family uniforms rushed out of their grand stone palaces in a hurry. Be it on ground or on air, they were all staring at the sky in shock.

“Rumble!”

A lightning bolt the size of a giant dragon abruptly struck a giant flying spirit artifact.

The flying spirit artifact was almost one kilometer long, and it was filled to the brim with precious spirit materials the workers had excavated from the sea. Besides that, it was guarded by a dozen or so Fulfillment and Netherpassage Realm martial practitioners.

The giant lightning bolt had instantly destroyed the flying spirit artifact.

Everything and everyone aboard the ship had exploded in an instant. They didn’t even have enough time to let out a scream.

“It’s an enemy attack!”

“Prepare for battle!”

“There is an expert hiding in the clouds!”

Three Han Family elders screamed as they unleashed their own Soul Altars and took to the skies.

At the same time, blue light became intertwined with one another as they enveloped the island. It was the Han Family’s spirit energy light shield.

“Moon Tear!”

Qin Lie let out a soft cry as nine brilliant starlights suddenly flashed from the dark sky.

Those who were paying close attention would notice that the light dots were in fact shaped like crescents. They flew quickly and struck the Han Family’s spirit energy light shields like meteors.

“Crack!”

The dark light of the shield suddenly shattered into countless pieces. Then, the nine murderous weapons that looked like stars started flying all over the island.

Any Han Family martial practitioner hit by the blinding fast rays of light was instantly chopped into tiny pieces of flesh.

“Soul Altar, Frost Storm!”

The seawater of Blue Snake Sea suddenly turned into ice under the might of his Soul Altar.

“Crack crack crack!”

The ice exploded, and countless icicles started raining on the island from every direction. It was like a stormy, unstoppable disk that kept raining murder onto the island.

Tens of thousands of ice swords attacked the island at once!

Without the protection of their spirit energy light shield, the Han Family martial practitioners who were already being slaughtered by Moon Tear could do nothing but stare in despair at the icy projectiles.

“Pfft!”

The sounds of sharp objects penetrating flesh kept resounding from the bodies of the Han Family members. All these people lost their lives in just an instant.

You are reading Spirit Realm Chapter 1327: Mass Slaughter on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

MAGUS INFINITE cover
Same genre

MAGUS INFINITE

BRICKTRADER ·Fantasy

ElricVossissixteenyearsold,tworanksaboveuseless,andhewakesuponehourbeforeeveryonearoundhimdies.TheCaelithMourneexpeditionhascampedatthebaseofasky-f...

Book of The Dead cover
Same genre

Book of The Dead

RinoZ ·Fantasy

Withonetouchofthestone,TyronreceiveshisClassandhislifechangesforever.Inan...Readmore Withonetouchofthestone,TyronreceiveshisClassandhislifechangesf...

The Innkeeper cover
Trending now

The Innkeeper

lifesketcher ·Action

Inthedepthsofanewbornuniverse,acultivatortakesadvantageoftheabundantenergytorefinehimselfatreasure.Butafter14billionyearsofrefiningandquiteafewmore...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.