Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1749: Bloodline Ascension from Spirit Realm, a Fantasy novel by Ni Cang Tian.

At Flaming Sun Purgatory.

Giant asteroid fragments were falling to the burning ground and being part of the Vermillion Bird Realm.

From time to time, Vermillion Birds would chirp happily and soar to the sky from between the lava cracks.

“Whoosh whoosh!”

A crimson Vermillion Bird suddenly flew out of the heart of the Vermillion Bird Realm’s volcano and left behind a beautiful, fiery rainbow in the red sky.

“Lord Tong Yan.”

“Congratulations, my lord!”

A lot of Vermillion Birds surrounded Tong Yan while chirping their congratulations.

“Whoosh!”

After flying out of the heart of the volcano, Tong Yuan took on a human form.

“Congratulations.” Tong Zhenzhen also congratulated her after changing into a human.

Ever since the Vermillion Bird Realm had bee merged with Flaming Sun Purgatory, the Vermillion Birds had swiftly adapted to their environment. Everyone’s bloodline was improving at a swift rate.

The accumulation of power had allowed the former rank nine Tong Yan to finally ascend her bloodline to rank ten.

This meant that she was now the indisputable strongest expert of her race.

“You too will ascend to rank ten one day.” Tong Yan smiled and said to Tong Zhenzhen, “This place is like the holy land we sought for. As long as we keep cultivating here, a large number of our people will be able to reach rank ten, and those who are sufficiently talented will bee rank ten Vermillion Birds just like me.”

“Yes, this place is just perfect for us,” Tong Zhenzhen agreed emotionally.

“It’s all thanks to Qin Lie.” Tong Yan probed her surroundings for a bit before taking to the sky suddenly.

When she looked down from the sky, she realized that the Vermillion Bird Realm wasn’t the only realm that was shrouded in flames. Everything beyond their domain was burning as well.

Moreover, she could sense a strange lifeform absorbing Flaming Sun Purgatory’s rich energy and converting it into flame energy.

She knew that that strange lifeform was the fire-attribute Spirit of Void and Chaos.

Suddenly, a terrifying ripple of flesh and blood energy hit her from far, far away.

“Hmm!”

Tong Yan’s expression changed the second she sensed it.

“It’s Qin Lie!”

She immediately flew toward the Origin Sea with speed that couldn’t be tracked with the eye.

At the same time.

Xue Li and Jiang An were cultivating in other areas. They also sensed Qin Lie’s energy.

“Swhoosh swhoosh swhoosh!”

The six Spirits of Void and Chaos who had successfully ascended to rank nine were also flying toward Qin Lie from six different domains.

Above the Origin Sea.

Wisps of rich abyss devil energy rose to the air like clouds and entered Qin Lie’s body.

Qin Lie’s body began devilization after he was pletely wrapped in abyss devil energy.

Soon after, he transformed into a high rank Abyss Devil about three meters tall.

“Whoosh!”

His translucent Soul Altar entered the corner of his eyes and into his head.

“Thump thump! Thump thump!”

His heart pumped as loud as a drum and brimmed with power.

He noticed that the bloodline crystals littered covering the heart were glowing purple.

His devilized body was absorbing abyss devil energy into himself like a powerful magnet.

Columns of abyss devil energy were concentrated inside his body.

Cracking noises came from his inside body as he started swelling at a visible rate again.

Dozens of seconds later, he had bee a thousand-meter tall Lord of the Abyss.

His pupils shone like a pair of purple lights.

His knees, elbows and shoulders were covered in sharp spikes. His chest was covered in black, horny substance.

“Roar!”

His Abyss Devil Race bloodline was clearly urging him to absorb even more abyss devil energy.

This time, rivers of purple energy flowed into his thousand-meter tall body.

“Crackle!”

Purple lightning that came from nowhere slithered across his skin and tempered his body.

“He’s about to bee a rank ten Great Lord of the Abyss,” Tong Yuan said.

She was surprised to find Jiang An, Xue Li and Miao Fengtian near the Origin Sea.

She didn’t know that a large majority of Qin Lie’s soul servants were dragged over to Flaming Sun Purgatory during the start of its transformation.

Right now, Qin Lie was as big as a mountain. As Jiang An stared at him from the sky, he said with deep respect, “A rank ten Great Lord of the Abyss. I’ve known him for only a hundred years. I never imagine that he’d make it this far so quickly. Truly unbelievable.”

“His very existence is a miracle,” Xue Li said solemnly.

A handsome high rank Abyss Devil reached them while they were conversing to each other.

“When master finishes his evolution, he’ll naturally bee a Devil Monarch. Only then can Flaming Sun Purgatory truly be considered an Abyss Purgatory.”

This high rank Abyss Devil was Vitas. Once he sensed Qin Lie’s aura from Jiang An, Miao Fengtian and Xue Li, he immediately figured out what kind of relationship they shared with Qin Lie.

Vitas was a high rank Abyss Devil, so he knew better than the others what Qin Lie’s transformation meant.

“Flaming Sun Purgatory has pletely devoured and refined Yellow Springs Purgatory.” Vitas looked at Qin Lie before continuing. “Master’s knowledge of the basic core laws of the Abyss must’ve reached a level where he can begin his ascension. That is why his heart had begun the process of tempering and evolving his body to perfection of its own accord.”

“Whoosh!”

Suddenly, a giant, burning meteor flew out of the Vermillion Bird Realm and stopped above the Origin Sea.

Tong Yan was shocked when she saw it.

She didn’t know that the giant burning meteor was the life crystal of the King of Flame Devils, but she did know that it was the object that caused the entire Vermillion Bird Realm to be transported to Flaming Sun Purgatory.

She was also aware of the special connection between the burning meteor and Qin Lie.

“Whoosh whoosh whoosh!”

Part of the abyss devil energy rising from the Origin Sea suddenly entered the burning meteor.

The purest and most ancient aura of the Abyss Vitas had ever felt burst out of the burning meteor and enlivened his bloodline.

Vitas was originally an Abyss Devil of the Extreme Flame Abyss. He had the Flame Devil Race’s bloodline in him.

“T-this is…”

Vitas stared wide-eyed at the burning meteor. He suddenly found himself incapable of speech.

The life crystal of the King of Flame Devils was quite far away from him.

However, he had awakened a new bloodline ability due to the Flame Devil Race bloodline he possessed.

“That’s it!” Shock coursed through Vitas’ body.

You are reading Spirit Realm Chapter 1749: Bloodline Ascension on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Book of The Dead cover
Same genre

Book of The Dead

RinoZ ·Fantasy

Withonetouchofthestone,TyronreceiveshisClassandhislifechangesforever.Inan...Readmore Withonetouchofthestone,TyronreceiveshisClassandhislifechangesf...

Lust Devil's Rise cover
Same genre

Lust Devil's Rise

TheDragonSlayer ·Fantasy

ArchangelLuciferishumanity'sguardian,lockedinanendlesswaragainstotherarchangelsontheplanetEden.Theysubordinateracesastheirproxies:elves,dwarves,and...

The Innkeeper cover
Trending now

The Innkeeper

lifesketcher ·Action

Inthedepthsofanewbornuniverse,acultivatortakesadvantageoftheabundantenergytorefinehimselfatreasure.Butafter14billionyearsofrefiningandquiteafewmore...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.