Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.

Spirit Realm Chapter 1784: Act First!

Novel: Spirit Realm Author: Ni Cang Tian Updated:
Font Size
18px
Now reading: Chapter 1784: Act First! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Flaming Sun Purgatory.

Qin Lie's seven-thousand-meter body floated above a volcano in Vermillion Bird Race’s domain. The fire spirit in the shape of a fire qilin sat atop his shoulder.

'"Qin Lie!"

Tong Yan of the Vermillion Bird Race saw him appear and cheered excitedly, "Just now, just now! Fire energy poured in!"

Qin Lie grinned and nodded. His hand grabbed towards the peak of the volcano.

"Sst!"

The life crystal of the Flame Devil King flew out of the heart of the volcano and landed in his palm.

Qin Lie's body suddenly moved and disappeared from this area.

In the next moment, he fell into the Origin Sea. Half of his body was under the sea while his upper half remained above the surface.

"Whoosh!"

His one-level Soul Altar flew out of his mind and floated in front of him.

He tightly gripped the life crystal of the Flame Devil King and slowly pressed it towards his one-level Soul Altar.

"Castor, Flame Devil King..."

Lightning flashed in his deep purple eyes. He looked coldly at the Soul Altar and the Flame Devil King's life crystal growing coser.

At a corner of the crystal Soul Altar, a purple crystal suddenly grew bright.

"Hmph!"

Qin Lie's hand gripping the Flame Devil King’s life crystal suddenly stopped. Then he gathered his enormous soul consciousness and charged towards the purple crystal!

A thick wave of death presence spread from the purple crystal embedded in the Soul Altar.

"Hiss-crack! Zzt zzt!"

Suddenly, the consciousness containing Qin Lie's soul concept turned into fire and immediately entered the purple crystal.

Moments later, Qin Lie’s strand of soul imbued with the power of fire entered the core.

"Argh! Woo woo woo!"

The wails of billions of phantoms and dead souls came from all directions. Many specks of light containing the laws of dead souls attacked Qin Lie's Soul Altar in the purple crystal like bombs.

"Power of destruction!"

Qin Lie's burning soul released power of destruction. The wisps of flame burned fiercely and ignited the specks of dead souls’ power, ceasing the wailing of the attacked phantoms.

Qin Lie's soul maintained its clarity and calm as it examined the internal structure of the purple crystal for the first time.

He found he was inside an enormous purple crystal world. Here, there were millions of phantoms and wraiths, as well as eight gas-like Nether Rivers!"

The eight gaseous Nether Rivers were a deep purple color and criss-crossed with one another.

Countless phantoms and wraiths floated around these eight Nether Rivers whose water glittered with purple stars.

Each purple star flashed with a different truth of the power of dead souls, recording Castor’s lifetime understanding of power.

At the biggest intersection of the Nether Rivers, millions of purple lights were gathered together and seemed to form a unique soul.

That souls seemed to be Castor's main soul!

"You still dream that when your eight avatars recover to their peak, you can replace me and bee the master of this Perfect Blood body?"

Qin Lie's invading soul burned with hot flames as he slowly passed through the criss-crossing Nether Rivers and headed toward the intersection.

"Woooo wooo!"

As his soul moved, millions of phantoms and wraiths howled and tore at his soul.

At the same time, purple light suddenly appeared on his Soul Altar in the outside world.

Those lights spread from inside the purple crystal and started to fill his Soul Altar.

In this moment, he could clearly sense Castor's eight avatars’ howls ing from the upper hundred Abyss levels!

"e in!"

Qin Lie's soul snorted and issued a summon.

Outside, the life crystal of the Flame Devil King immediately shrank thousandfold.

The life crystal of the Flame Devil King turned into a small dot of flame and shot into the purple crystal.

"Whoosh!"

The fiery dot burrowed into the purple crystal, entering the same purple world as Qin Lie’s soul!

"Whoosh whoosh whoosh!"

The life crystal of the Flame Devil King returned to its normal size after entering the world of dead souls.

In but an instant, it once again became an enormous blazing meteor.

It gushed with lava, flames sprouting on its surface!

The released flames produced light emanating with pure truths of fire, threatening to burn the entire domain!

"Very good!" Qin Lie laughed.

Not long ago, when he fought the Molten Rock Monarch, the life crystal of the Flame Devil King clearly had other thoughts.

But at the crucial time, when he and the fire spirit worked together to activate flame consumption, the life crystal of the Flame Devil King quickly realized its situation.

It quickly left and flew back into Vermillion Birds’ domain docilely to show its stance.

Since it had made its choice, and since Castor's eight avatars were quickly gathering power and were about to recover to their peak, Qin Lie did not want to wait anymore.

He and the other Devil Monarchs didn’t have the same agenda. He did not want to waste time and go to the upper hundred Abyss levels to kill Castor's eight avatars.

He chose to attack Castor's main soul early!

Castor's main soul, that purple crystal, had already merged with his Soul Altar. If he wasn't careful, he would suffer a backlash and his soul would be destroyed.

Due to this fact, he had been hesitating before and did not dare move rashly.

But now, he had bee a true Devil Monarch. With every moment, his subsouls were prehending all kinds of laws to increase his power.

Most importantly, the life crystal of the Flame Devil King had made a clear choice through his previous battle with the Molten Rock Monarch.

Regardless of the Flame Devil King’s play, they shared mon enemy, Castor!

Since that was the case, he could bring the life crystals into the domain Castor’s main soul had created and refine Castor’s main soul!

"Qin Lie acted early!"

"Damn it!"

"He dares to attack us early!"

In the upper hundred Abyss levels, Castor's eight avatars were still tearing at the bodies of Great Lords of the Abyss and eating their hearts.

Of Castor's eight avatars, five had already recovered their peak strength, and the last three would also recover soon.

But now, scattered around different Abyss levels, they felt the danger faced by the main soul.

"He dared to summon the power of the Flame Devil King! He must have started early!"

Castor's eight avatars immediately made a decision, howling angrily as they tore spare apart.

In the sky of Flaming Sun Purgatory, eight spatial cracks appeared. Then Castor's avatars in the form of eight Great Lords of the Abyss suddenly appeared!

"Auston! I helped you force Castor out!" Qin Lie shouted.

"We're ing!"

You are reading Spirit Realm Chapter 1784: Act First! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

My Arms Can Turn into Blades cover
Trending now

My Arms Can Turn into Blades

Ode ·Fantasy

ChenLuSifindsastrangestoneandmeetsastrangegirlduringhistombsweeping.Afterthegirlslasheshimwithasword,hefindsthathecouldn'tcontrolhiswholebodybuthis...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.