Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1785: Bitter Fight! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

The sky of Flaming Sun Purgatory suddenly cracked like glass.

Castor’s eight avatars appeared in the rifts as Great Lords of the Abyss.

Qin Lie, who was prepared, immediately municated with Auston.

"Crack!"

Another set of spatial rifts appeared as gargantuan claws ripped the sky apart. The Devil Monarchs, led by Auston, howled as they charged into Flaming Sun Purgatory.

Including the Molten Rock Monarch that had just fought with Qin Lie!

"Castor!"

When Auston appeared, he shouted angrily and stared at Castor's eight avatars.

"Whoosh whoosh!"

Surging rays of starlight gathered and formed a star door.

Qin Lie's two Soul Beast avatars flew back from Sky Bearing City and the space of the Bone Race.

ing together with his Dark Soul Beast avatar was his father Qin Hao!

ing with his Blood Soul Beast avatar was the patriarch of the Bone Race, Lartigau, Great Elder Bredo, and their Corpse Demons!

"Howl!"

The eight Undying Titans also shouted as they flew up from near the Origin Sea.

"I want to refine Castor's main soul. You help me defend against his eight avatars!" Qin Lie shouted.

"Alright!" Auston agreed with a laugh.

Beside a dark red cloud, Qin Lie's Dark Soul Beast avatar said seriously, "Father, keep some strength to prevent Tian Qi and Lieyan Yuan from causing trouble."

Qin Hao, who hadn't even taken out his nine-level Soul Altar, nodded slowly. "Yes."

When Qin Lie decided to attack Castor's main soul, the two avatars had secretly prepared. Over in Sky Bearing City, his Dark Soul Beast avatar and Qin Hao had not participated in the alliance with the foreign races.

They were waiting for this moment to arrive.

"Auston! You seven are seeking your own death! Once I bee the Abyss Master again, I will kill you seven, and select seven new Devil Monarchs to replace you!"

One of Castor's bodies roared and threatened.

"We killed you once, we can kill you again." Auston was fearless.

"Reckless!"

As Castor shouted, his eight Abyss Devil avatars turned into enormous balls of flesh.

The eight balls rolled and gathered together in an instant.

"Crack crack!"

The sound of bones cracking came out of the enormous flesh ball. The flesh ball expanded and continued to transform.

In a short dozen seconds, the enormous flesh ball turned into a Great Lord of the Abyss nine thousand meters tall.

This enormous Great Lord of the Abyss had eight heads, and a long tail ten thousand meters long. He had curved horns on his head, and wings on his back. His presence was permeated with aura of death.

Countless phantoms and ghosts came out of his mouth and nose as he breathed.

In a flash, billions of phantoms and ghosts filled the sky of Flaming Sun Purgatory.

"Whoosh whoosh whoosh!"

At the same time, eight Nether Rivers that had disappeared from the Eight Purgatories seemed to fly out of the enormous body and floated high above the clouds of Flaming Sun Purgatory.

When those eight Nether Rivers appeared once again, the laws of the Flaming Sun Abyss seemed to have been forcibly altered.

Dense death aura seemed to rise from the earth of Flaming Sun Purgatory. All the beings living in Flaming Sun Purgatory felt that their souls were being pulled by an unknown power out of their bodies.

"You think your shallow knowledge of the Abyss laws can stop me from being the Abyss Master?"

Inside Castor's domain, his cold laughter came from the intersection point of the eight gaseous Nether Rivers.

"Snap snap snap!"

Inside the gaseous Nether Rivers, billions of purple stars flashed and suddenly exploded.

The truths of the power of dead souls scattered into the surroundings, covering the entire world.

Similar things were happening outside in Flaming Sun Purgatory.

The local Abyss Devils suddenly found their souls being pulled out of their bodies.

Unless their bloodline reached rank ten or they were Genesis Realm experts, the souls of other beings were affected by Castor's dead souls’ power.

In the land of the Vermillion Bird Race, Tong Yan watched as the souls of other weaker Vermillion Birds turned into specks of light that flew out of their bodies.

The souls of Curtis and the other Asura Race soul slaves flew out of their physical bodies along with their Soul Altars.

Even Miao Fengtian, Jiang An, and Xue Li could not control their souls and Soul Altars. They could only watch as they left their bodies.

Clusters of souls flew out all over Flaming Sun Purgatory in this moment.

Once those souls left their physical bodies, they started to be affected by Castor's power.

Their living souls were being altered by the power of dead souls, tainting them with the power of death.

If this continued, soon those living souls of Flaming Sun Purgatory would be turned into dead souls by Castor.

And dead souls were Castor's power source!

The more dead souls there were, the stronger Castor would bee. He would be able to fight a bitter fight even against the seven Devil Monarchs and Qin Lie!

"Reorganize the core laws!"

Qin Lie's Dark Soul Beast avatar turned back into its Soul Beast shape and roared.

"Whoosh whoosh whoosh!"

The six Spirits of Void and Chaos flew out of Qin Lie's seven-thousand-meter-tall body. They turned into six bright rays of light that scattered towards six areas of Flaming Sun Purgatory.

The Spirits of Void and Chaos had used Flaming Sun Purgatory to create their own domains. Their shapes, structures, and laws were all based on spirits’ preferences and will.

The laws and truths of the six worlds were not the same as the laws of the Abyss!

The six Spirits of Void and Chaos released their unique power and did their best to use their bloodline to stabilize the six lands they had formed.

"Whoosh whoosh whoosh!"

Suddenly, the souls from those six worlds suddenly dropped back into their respective bodies.

Tong Yan clearly saw that when the fire qilin flew back from Qin Lie, her clansmen’s souls returned!

The arrival of the fire spirit caused the local laws of fire to bee steady and impenetrable!

Even Castor's power of dead souls was unable to affect them here. He could not affect this land of fire, or turn the souls of the Vermillion Birds into dead souls!

Similarly, the souls floating out of the other five domains returned to their bodies due to the return of the five Spirits of Void and Chaos!

"What has your Flaming Sun Purgatory created? Why is it not built according to the ancient laws of the Abyss!"

Castor's bellow came from inside his dead soul domain inside the purple crystal. Feeling the sudden change, he was clearly panicking.

He had once been the Abyss Master. His understanding of the ancient laws of the Abyss naturally surpassed Qin Lie.

He believed that Qin Lie's Flaming Sun Purgatory had been formed based on the ordinary Abyss laws. With his understanding of the Abyss laws, he could override fundamental laws of Flaming Sun Purgatory with the laws governing the power of dead souls!

As long as the fundamental laws of Flaming Sun Purgatory were the ancient laws of the Abyss, he could replace them with power of dead souls!

But Qin Lie's Flaming Sun Purgatory was structured pletely different from what he imagined.

The existence of the six Spirits of Void and Chaos caused Qin Lie's Flaming Sun Purgatory to contain myriad transformations that other purgatories didn’t have.

Those magical changes and variations prevented him from overriding Flaming Sun Purgatory’s laws!

You are reading Spirit Realm Chapter 1785: Bitter Fight! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.