Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1786: Soul Altar Split from Spirit Realm, a Fantasy novel by Ni Cang Tian.

In Flaming Sun Purgatory, those souls that had left their bodies returned due to the arrival of the six Spirits of Void and Chaos.

Castor's power of dead souls was unable to override the fundamental laws of Flaming Sun Purgatory!

"We cannot let him continue to make trouble!"

The Nine Hells Monarch Auston saw Castor attempting to change the laws of Flaming Sun Purgatory, so he charged at the former Abyss Master.

"Kill him again!"

The other six Devil Monarchs knew if Castor was fully restored, he wouldn’t let them off lightly.

"Whoosh whoosh whoosh!"

The seven Devil Monarchs led by Auston were like seven mountains of flesh. They neared Castor and used their claws, blades, and all kinds of bloodline abilities to attack Castor.

Purple rays of light lit up the sky of Flaming Sun Purgatory.

As the Devil Monarchs released the light, the rays aligned themselves into patterns that represented unique laws of the Abyss.

The nine-thousand-meter-tall Castor roared and seemed to wave the eight Nether Rivers.

The eight floating Nether Rivers and Castor's enormous tail swept at the same time.

"Howl!"

In a flash, Castor and the seven Devil Monarchs engaged in melee bat.

All kinds of profound laws collided between them as their physical bodies tore at one another.

Purple blood sprinkled everywhere, raining downwards. Each and every drop contained most profound laws prehended by the Devil Monarchs.

"Boom!"

The sky of Flaming Sun Purgatory could not endure their power, rending apart with enormous rifts.

"Whoosh whoosh whoosh!"

Light ing from unknown outer realms fell through.

At the same time, Qin Lie's Dark Soul Beast and Blood Soul Beast avatar moved and gathered near Castor.

"Whoosh whoosh!"

The many phantoms and ghosts flew through Castor's nose and mouth. They fed at the flesh and blood of those Devil Monarchs as Castor fought them.

Some of the biggest phantoms seemed to resemble Castor in appearance.

Under Castor’s influence, truths of dead souls enhanced the strength of these ghosts and phantoms.

"Soul Split!"

Qin Lie's two Soul Beast avatars looked coldly at Castor and shouted.

Thousands of flashing green flames flew out of his two Soul Beast avatars.

Those green flames were imprinted with truths prehended by both of his avatars.

When those green flames spread near the wraiths and vile souls near Castor, they deconstructed both the dead souls and the acpanying aura of death.

Under the assault of green flames, the enormous amalgamations of dead souls split into smaller parts.

"Soul devouring!"

Qin Lie's two Soul Beast avatars channeled another secret art.

Their mouths released soul suction force, affecting the surrounding phantoms, ghosts, wraiths, and vile souls.

The weaker dead souls were pulled toward the maws of the Soul Beasts.

After Qin Lie's main body reached rank ten and he became a Devil Monarch, his understanding of many different laws of power increased tremendously.

This caused his two Soul Race avatars to reach a new level in their understanding of the Soul Race secret arts and the Soul Race bloodline!

"Whoosh whoosh whoosh!"

Soon, the dead souls and wraiths were gone, devoured by the two Soul Beasts. This decreased the pressure on the seven Devil Monarchs by a lot.

They did not have to worry too much about Castor's dead souls’ power and could focus on attacking Castor's nine-thousand-meter-body!

"Go!

The Bone Race's Lartigau and Bredo finally issued an order.

The Giant Star Beast that Bredo had refined and a dark black dragon corpse charged into the sky to tear at Castor's body.

That giant black dragon was the strongest Corpse Demon of the Bone Race, and was even more terrifying than the Corpse Demon refined from a Titan Race clansman that had caused waves during the civil war at the Bone World.

The giant black dragon could almost rival a Devil Monarch in power.

Also, the giant black dragon was covered in aura of death and could ignore the power of dead souls.

"Alright!"

Auston saw the reinforcements ing and grew excited. He shouted, "Today, we will make Castor truly perish in Flaming Sun Purgatory!"

"Kill him!" the other Devil Monarch echoed.

At the same time.

Qin Lie's soul attacked Castor inside the purple crystal.

As the life crystal of the Flame Devil King released blazing inferno to burn the domain down, Qin Lie’s soul released peculiar light.

A destructive presence was unleashed and illuminated Castor’s space. Whenever it came into contact with a dead soul, the latter would be disintegrated.

This was the Light of Destruction that even the shadow beings feared!

"Castor, this is not your time. Your era… ended when you died." Qin Lie sneered and said, "You dream of continuing to rule the Abyss in a new era. I can only destroy your delusion."

At this time, the Flame Devil King’s life crystal and the Light of Destruction his soul was releasing started destroying the domain Castor had created.

As the many phantoms and wraiths in Castor's space turned to nothingness, he could feel the laws of power governing this domain being affected.

It felt just like when Grom’s Yellow Springs Purgatory was slowly crumbling.

"Crack!"

Yet an untimely sound startled the smug Qin Lie.

He suddenly found as Castor's dead souls space collapsed, his one-level Soul Altar showed signs of cracking!

He could hear that his Soul Altar was about to shatter because of the purple crystal.

He was shocked!

"No!"

Recognizing the danger, he hurriedly stopped releasing the Light of Destruction and caused the life crystal of the Flame Devil King to stop.

Outside, he looked in shock at his enormous one-level Soul Altar.

He could clearly see when the purple crystal was on the verge of crumbling, his Soul Altar was also cracking.

Those cracks, if they spread across the entire Soul Altar, when Castor's main soul in the form of the purple crystal shattered, his Soul Altar... may shatter as well!

"It is not so easy to destroy my main soul! Flaming Sun Monarch, from when I merged my main soul into your Soul Altar, I became one with your Soul Altar!" Castor laughed from amidst dead souls. "My dead soul domain has bee a part of your Soul Altar. You destroy my domain, you destroy your own Soul Altar! I know that the Soul Altar is the core of all your power concepts and the home of your soul. If your Soul Altar is destroyed, even if won’t die, you won’t be able rise to the apex!"

"Haha, I want to see if you can be so decisive!"

"If you destroy me, you destroy yourself!" screamed Castor.

You are reading Spirit Realm Chapter 1786: Soul Altar Split on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

I'm the Culinary God cover
Same genre

I'm the Culinary God

Greedy kitten ·Fantasy

LinXu,whoisabouttograduatefromuniversity,suddenlygetsboundtotheCookingGodsystemandhasbecometheownerofarestaurant.Totastehishandmadenoodles,customer...

I Have a Golden Crow cover
Trending now

I Have a Golden Crow

Great Yu ·Eastern

DuYuhasnoclueabouthowhehastransmigratedtoaworldofdemontaming.HeisalsoinastateofconfusionwhenhecontractstheGoldenCrowthatwasliterallyasun.“Areyoufro...

The Lucky Farmgirl cover
Trending now

The Lucky Farmgirl

Bamboo Rain ·Romance

TheFourthBrotherhadsquanderedhiswealththroughgambling,leavingtheirmotherinacriticalstate.Tomakemattersworse,thecreditorsevenaskedthemtosellManbaoto...

Supreme Vision Master cover
Trending now

Supreme Vision Master

Mo Yan ·Fantasy

Cultivationdestroyed,eyespoisonedblindandrobbedofherstatusinthehousehold? LuoQingtongnarrowshereyesandsneers,“Bringiton!Letmeteachyoualesson!” A24t...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.