Read light novels, web novels, Chinese novels, Korean novels, Japanese novels and books online for FREE.
Font Size
18px
Now reading: Chapter 1787: Killing the Avatars First! from Spirit Realm, a Fantasy novel by Ni Cang Tian.

Inside the dead soul domain.

Qin Lie calmed down quickly as Castor’s threats rolled over his head. He ordered the Flame Devil King's life crystal to leave first.

He had also stopped shooting Light of Destruction since a while ago.

“What’s wrong? Did the fear finally reach you?” Castor’s ridiculing voice came from the gaseous Nether River, “You should’ve realized that this day would e the moment you obtained the purple crystal and tried to study my dead soul power in greed.”

“There are many things that don’t belong to you. There are prices that must be paid if you wish to own something!”

“Because your Soul Altar had absorbed the crystal of my main soul, you were able to learn a portion of my dead soul power and survive many dangerous situations, didn’t you?”

“You understand now that this help isn’t free, don’t you?”

Castor said tauntingly.

Inside the dead soul domain, Qin Lie continued to stay silent.

It was as Castor said. When his Soul Altar absorbed the purple crystal, he also learned the truths of the dead soul power.

The power of dead souls had played a major role in several difficult battles in the past.

He was so absorbed in this strange and profound power that he was studying it even when Flaming Sun Abyss was transforming into Flaming Sun Purgatory.

He realized that Castor’s dead soul power did help him a lot.

However, he didn’t realize that this was just a trick by Castor. As a result of him studying the truth of power of the dead soul, the connection between his Soul Altar and Castor’s purple crystal grew tighter and tighter.

This was how Castor planned to corrupt him and replace him altogether once all eight of his avatars had returned to peak strength.

When he tried to destroy the dead soul domain, he discovered that Castor’s purple crystal had already bee a part of his Soul Altar.

Destroying the dead soul domain might result in the destruction of his own Soul Altar.

“I guess I have to do this another way the.”

A while later, Qin Lie made up his mind and withdrew his soul consciousness from Castor’s dead soul domain.

An instant later, Qin Lie’s soul consciousness had returned to his body.

While gripping the Flame Devil King's life crystal in one hand, he recalled his Soul Altar back into his glabella.

He turned his attention to Castor’s avatars in the outside world.

“I can’t kill your main soul yet, so I’ll kill all your avatars first!”

He let out a roar and charged toward the nine-thousand-meter-tall Castor.

“Swhoosh!”

The Flame Devil King's life crystal was even faster than Qin Lie, slamming into Castor’s head first.

“Zzzt!”

Gold and purple lightning flew out of his pupils. The bolts contained hints of fiery sparks.

That wasn’t all. He made a grabbing motion with one hand and activated the power of absolute frost.

“Crack crack crack!”

A giant sword of ice instantly came into existence.

The giant sword looked crystalline and translucent. Light flowed inside its body, its aura bone-chilling.

“Sizzle!”

He then conjured another giant sword made of crimson flames in the other hand.

“Castor! I’ll kill all eight of your avatars first! Let’s see how you can possess me after all eight of your avatars are dead!”

Qin Lie roared and pounced toward Castor. His giant swords contained the power of absolute frost and blaze.

His two Soul Beast avatars immediately moved out of the way when they saw their real self.

He was able to meet Castor head on!

“Kill me? You think the likes of you can kill me?” Castor laughed savagely before swinging his tail. The appendage was almost ten thousand meters long.

“Crackle!”

The space behind Castor’s tail was crawling with lightning. The sheer force behind the tail had opened a narrow rift in space itself.

The Molten Rock Monarch and the Plague Monarch felt like they were cut by a billion blades because they were near the assailing tail.

“Pfft!”

Blood gushed out of the two Devil Monarchs’ bodies as they backed away from Castor.

“Watch out! His tail can rip space apart!” the Plague Monarch hurriedly warned Qin Lie.

“Crack crack crack!”

As the spatial rift grew longer and longer, countless rays of outside light burst out of it.

They were as sharp as actual blades, and there were millions of them.

“It’s useless,” Qin Lie said with a cold snort.

His bloodline power changed, and the Demon Spirits of Space and Time’s sacred relic, the Galaxy Mirror, abruptly appeared behind his pupils.

The space that was torn apart by Castor’s tail immediately healed in a short time.

In a moment, Castor could no longer swing his tail as wantonly.

“Crack!”

At the same time, Qin Lie slammed his giant sword of ice straight into Castor’s tail.

“Roar!”

Castor let out an angry roar and shook his tail once. A shower of light sprinkled in all directions.

The cries of billions of wraiths and phantoms could be heard from the light. Qin Lie felt as if he was being swarmed by countless shadow locusts.

By the time he came back to his senses, he discovered that the phantoms and wraiths were on him and feeding on his flesh and blood.

“Foolish!”

Qin Lie roared and covered his flesh and skin in crimson flames.

The crimson flames had traces of the power of destruction in them. He was able to passively and gradually kill the phantoms and wraiths clinging onto him.

At the same time, Qin Lie charged toward Castor and engaged him in a melee brawl.

Of the races in the universe, Abyss Devils boasted the strongest bodies and the most remarkable regenerative ability!

The battle between two Great Lords of the Abyss was quite often decided by the most primal and bloody ways of bat.

Right now, Qin Lie and the rest of the Devil Monarchs were fighting Castor’s avatars with their bodies.

“Zzzt!”

An ice blue lightning suddenly appeared from a spatial rift.

None of the Great Lords of the Abyss noticed it.

Not even Qin Lie’s Soul Beast avatars had realized the danger because they were busy dealing with entire hordes of dead souls and wraiths.

Qin Hao was the only one who let out a cold snort after the lightning’s appearance.

“Whoosh!”

His nine-level Soul Altar was brimming with the aura of destruction. It flew out of his glabella, and he sat on top of it.

A flash later, both the nine-level Soul Altar and him appeared next to the inconspicuous spatial rift.

“Boom!”

Qin Hao raised a hand and punched toward the narrow spatial rift. The impact resulted in a huge hole of vacuum.

“Cough cough!”

Furious coughs suddenly came out of the spatial rift.

Then, Tian Qi walked out of his hiding spot while looking a little embarrassed. He had the Scepter of Fate with him, and a trail of blood was trickling down the corner of his lips.

It would appear that Qin Hao had wounded him in one hit.

You are reading Spirit Realm Chapter 1787: Killing the Avatars First! on WuxiaFull. Use Previous, Chapter List, or Next to continue.
Share this chapter
Bookmark saves this novel to your account. Reading History keeps recent chapters in this browser.
Continuous reading

You May Also Like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Romance

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Fantasy

C;IfIdon9;tdie6;IswearIwillactonallmyevilthoughts..D; Notexactlyeveryone9;stypicalthoughtwhenthey9;reabouttodie.Whatwillacowardlyyoungmandowhenrein...

Lust Devil's Rise cover
Same genre

Lust Devil's Rise

TheDragonSlayer ·Fantasy

ArchangelLuciferishumanity'sguardian,lockedinanendlesswaragainstotherarchangelsontheplanetEden.Theysubordinateracesastheirproxies:elves,dwarves,and...

The Innkeeper cover
Trending now

The Innkeeper

lifesketcher ·Action

Inthedepthsofanewbornuniverse,acultivatortakesadvantageoftheabundantenergytorefinehimselfatreasure.Butafter14billionyearsofrefiningandquiteafewmore...

User Comments

0 comments from readers

Post Comment
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.