Summary
Theworldwascruel.....Especiallyforthosewhohadlosttheirchancestoshine.Aetherwasoneofthem....Aether,anindividualbornwithasilverspoon,foundhimselfdiscardedlikeadefectiveproduct.Hehadlongedforloveandtenderness,butwhatothersshowedhimwasnothingbutpain.Eveninthefaceofthatpain,hesmilednotbecausehewantedto,butbecausehehadnootherchoice.Despitetheheartbreak,heenteredintoahellcalledsocietywithabeautifulsmile.....“Can'tyoudoasinglething!!”“...”“Youarefired!!!”“....W-Wh..”“Iamsorry,Sir,butyouneedatleastabachelor'sdegreetoenterourcompany!!”“....I-Iam...”“Iamsorry,Sir,butwecannotprovidealoanforyourideaswithoutreassurance!!”“....W-Why?”“Iheardyourfatherisapolitician....So,Youknow....”“...”Afteralongstruggle,hefinallygotajob,buthisbrother'swordsranginhisears:“Yeah,yeah…Iknowyougotthejobthankstome,ofcourse.So,don'tevercontactmeorevenMYparents”hisbrotherdeclared.“...Heh...”Justashebelievedhehadearnedsociety'srecognition,anunforeseeneventclaimedhispathetic,seeminglyworthlesslife....“HONK!!HONK!!”Yet,amidstthecrueltyofsociety,hedefiantlycried,“IJUSTWANTTOLIVE!!!!!”Witnessinghisheartfeltcryanddesiretoliveinthehellishplacecalledsociety,hewasgrantedasecondchance.~Ding!~However,eveninthisnewlife,hissituationremainedunchanged.Hecontinuedtostrugglenotonlytoliveandeatbutalso.....seduction.“HOWDAREYOUSEDUCETHEPRINCESS!!”“.....he..he...B-ButIdidn'tseduceher!!”“HOWDAREYOUSEDUCEMYMOTHER!!”“...Hehe”“YOUHAVESOMENERVETOSEDUCEMYWIFE,DON'TYOU?”“HEHEHEHEHEE.....”
You May Also Like
Novel Chapters 1644
- Chapter 1644: Even the... shadows belong to us Jun 10, 2026
- Chapter 1643: You may address me as Epsilon Jun 10, 2026
- Chapter 1642: Release the Slave! Jun 10, 2026
- Chapter 1641: I’m not the only fish in the vast ocean Jun 08, 2026
- Chapter 1640: I... I’m sorry Jun 08, 2026
- Chapter 1639: I love you, Lackey Jun 07, 2026
- Chapter 1638: By selling yourself Jun 07, 2026
- Chapter 1637: Would you really be capable of creating someth Jun 07, 2026
- Chapter 1636: Invading Terra? Is it possible? Jun 07, 2026
- Chapter 1635: "Blood should be paid by blood!" Jun 05, 2026
- Chapter 1634: Vesperine... getting her love? Jun 05, 2026
- Chapter 1633: Second War... Over Jun 04, 2026
- Chapter 1632: We Fight Back Ruthless Too: Part-2 Jun 04, 2026
- Chapter 1631: We Fight Back Ruthless Too: Part-1 Jun 03, 2026
- Chapter 1630: Second Attack: Part-5 Jun 03, 2026
- Chapter 1629: Second Attack: Part-4 Jun 02, 2026
- Chapter 1628: May I come in? Jun 02, 2026
- Chapter 1627: Second Attack: Part-3 Jun 02, 2026
- Chapter 1626: Second Attack: Part-2 Jun 02, 2026
- Chapter 1625: Second Attack: Part-1 Jun 02, 2026
- Chapter 1624: The cycle is about to end… isn’t that right? Jun 02, 2026
- Chapter 1623: There is always an Exchange for everything!! Jun 02, 2026
- Chapter 1622: The Auction: Part-4 Jun 02, 2026
- Chapter 1621: The Auction: Part-3 Jun 02, 2026
- Chapter 1620: The Fallen Primordial Jun 02, 2026
- Chapter 1619: The Auction: Part-2 Jun 02, 2026
- Chapter 1618: The Auction: Part-1 Jun 02, 2026
- Chapter 1617: Welcome to Amara Rosavere’s Auction, esteemed Jun 02, 2026
- Chapter 1616: Before the Auction Jun 02, 2026
- Chapter 1615: Victor has Heart Meter too? Jun 02, 2026
- Chapter 1614: Initiate the next attack... President Jun 02, 2026
- Chapter 1613: [NO THREATS][SCANNING][NO ABNORMALITY][INCREAS Jun 02, 2026
- Chapter 1612: N-Now you see it... r-right? H-He... he is my Jun 02, 2026
- Chapter 1611: One Aevum... What kind of twisted system is th Jun 02, 2026
- Chapter 1610: In fact... it wasn’t always an Empire Jun 02, 2026
- Chapter 1609: Vesperine meets her Mother-in-law Jun 02, 2026
- Chapter 1608: I’ll give you your favourite ’cream pie’ later Jun 02, 2026
- Chapter 1607: MIL-ILF Hunter Jun 02, 2026
- Chapter 1606: Bro... Really? Going after your other Mother-i Jun 02, 2026
- Chapter 1605: Y-You’re so cruel… Mr. Lackey Jun 02, 2026
- Chapter 1604: They are Family: Part-2 Jun 02, 2026
- Chapter 1603: They are Family: Part-1 Jun 02, 2026
- Chapter 1602: Dark~Dark~Darkside! Jun 02, 2026
- Chapter 1601: To My Da~Da~Darkside! Jun 02, 2026
- Chapter 1600: Welcome to My Darkside Jun 02, 2026
- Chapter 1599: When Devil comes out... You won’t like it: Par Jun 02, 2026
- Chapter 1598: When Devil comes out... You won’t like it: Par Jun 02, 2026
- Chapter 1597: When Devil comes out... You won’t like it: Par Jun 02, 2026
- Chapter 1596: When Devil comes out... You won’t like it: Par Jun 02, 2026
- Chapter 1595: Starla having a impure thoughts about her Quee Jun 02, 2026
- Chapter 1594: Mommy’s going to find you Jun 02, 2026
- Chapter 1593: My lovely husband… I will protect you Jun 02, 2026
- Chapter 1592: Please Husband No more death... Please! Jun 02, 2026
- Chapter 1591: What is Mother’s Love? Connection? Obsession? Jun 02, 2026
- Chapter 1590: Mary Marries Victor? WTF!! Jun 02, 2026
- Chapter 1589: Even without Memories... Her man still the sam Jun 02, 2026
- Chapter 1588: Lia being pampered by her Aunt Jun 02, 2026
- Chapter 1587: Nyx couldn’t handle her Husband’s Charm! Jun 02, 2026
- Chapter 1586: Mary got NTRed by Vampire Aether!~ Jun 02, 2026
- Chapter 1585: The Mighty Bloody Vampire Fallen: Part-2~ Jun 02, 2026
- Chapter 1584: The Mighty Bloody Vampire Fallen: Part-1~ Jun 02, 2026
- Chapter 1583: Primordial Vampiric Demonic Blood Jun 02, 2026
- Chapter 1582: Aether becoming a Vampire? Jun 02, 2026
- Chapter 1581: Fire against Fire... who wins? Jun 02, 2026
- Chapter 1580: They are not going to regret it, are they? Jun 02, 2026
- Chapter 1579: Aether and Mary got NTR? Jun 02, 2026
- Chapter 1578: Let them Jun 02, 2026
- Chapter 1577: Aether and Mary shocked... Nyx rocked! Jun 02, 2026
- Chapter 1576: Hehe… today… I’m going to suck~ everything Jun 02, 2026
- Chapter 1575: Do you want to see him like this? Jun 02, 2026
- Chapter 1574: A Mob’s crush Jun 02, 2026
- Chapter 1573: A Mob’s Story: Part-5 Jun 02, 2026
- Chapter 1572: A Mob’s Story: Part-4 Jun 02, 2026
- Chapter 1571: A Mob’s Story: Part-3 Jun 02, 2026
- Chapter 1570: A Mob’s Story: Part-2 Jun 02, 2026
- Chapter 1569: A Mob’s Story: Part-1 Jun 02, 2026
- Chapter 1568: Everyone has their own story… a king, a soldie Jun 02, 2026
- Chapter 1567: Rise of Receptionist Jun 02, 2026
- Chapter 1566: Goods Delivered! Jun 02, 2026
- Chapter 1565: Vesperine is in... Love? Jun 02, 2026
- Chapter 1564: Oath of El Kova’reth Jun 02, 2026
- Chapter 1563: Humiliated by Vesperine Jun 02, 2026
- Chapter 1562: Victor is the Final Boss Jun 02, 2026
- Chapter 1561: There is a girl inside Vesperine, you know? Jun 02, 2026
- Chapter 1560: Capturing the Monsters Jun 02, 2026
- Chapter 1559: Got a Metallic Hand Jun 02, 2026
- Chapter 1558: One Last lullaby Jun 02, 2026
- Chapter 1557: When No.25 joined the dance: Part-4 Jun 02, 2026
- Chapter 1556: When No.25 joined the dance: Part-3 Jun 02, 2026
- Chapter 1555: When No.25 joined the dance: Part-2 Jun 02, 2026
- Chapter 1554: When No.25 joined the dance: Part-1 Jun 02, 2026
- Chapter 1553: Iskha’vel Jun 02, 2026
- Chapter 1552: No matter what, DO NOT LOOK!! Yet Jun 02, 2026
- Chapter 1551: Why? Why? WHY?!! Jun 02, 2026
- Chapter 1550: ... Death... Death... Death Jun 02, 2026
- Chapter 1549: Death... Death... Death Jun 02, 2026
- Chapter 1548: ... Until war reminds it how fragile joy is: P Jun 02, 2026
- Chapter 1547: ... Until war reminds it how fragile joy is: P Jun 02, 2026
- Chapter 1546: A cheerful world makes a cheerful hearts Jun 02, 2026
- Chapter 1545: Official Engagement of Elysiumis Aurora: Part- Jun 02, 2026
- Chapter 1544: Official Engagement of Elysiumis Aurora: Part- Jun 02, 2026
- Chapter 1543: Official Engagement of Elysiumis Aurora: Part- Jun 02, 2026
- Chapter 1542: Official Engagement of Elysiumis Aurora: Part- Jun 02, 2026
- Chapter 1541: These People... are really something else! Jun 02, 2026
- Chapter 1540: Was he... reckless? Jun 02, 2026
- Chapter 1539: Being Master of three pets is not easy, you kn Jun 02, 2026
- Chapter 1538: Accepting the Contract Jun 02, 2026
- Chapter 1537: Snowflake got violated by Freaks! Part-2 Jun 02, 2026
- Chapter 1536: Snowflake got violated by Freaks! Part-1 Jun 02, 2026
- Chapter 1535: Mech-Suits? Interesting word Jun 02, 2026
- Chapter 1534: Frostblade Household under attack? Jun 02, 2026
- Chapter 1533: Taking Snake with him Jun 02, 2026
- Chapter 1532: Pregnant From Kiss? Is that Possible? Jun 02, 2026
- Chapter 1531: Find a woman called Vesperine... And kill her Jun 02, 2026
- Chapter 1530: Mary needs purification! Jun 02, 2026
- Chapter 1529: Kaelen lies to his father Jun 02, 2026
- Chapter 1528: Vesperine Wants to Marry Aether? Jun 02, 2026
- Chapter 1527: Aether Zephyra... The First Supremacy Jun 02, 2026
- Chapter 1526: Being Sucked feels good, right? Jun 02, 2026
- Chapter 1525: The Two Crooked Beings Jun 02, 2026
- Chapter 1524: That beautiful river, under the grey sky Jun 02, 2026
- Chapter 1523: He has a Magic DK? Jun 02, 2026
- Chapter 1522: A Connection? Jun 02, 2026
- Chapter 1521: Remember... The Answer has already been given Jun 02, 2026
- Chapter 1520: Being Sisters: Part-2 Jun 02, 2026
- Chapter 1519: Being Sisters: Part-1 Jun 02, 2026
- Chapter 1518: ~My Mother-in-law is being little naughty woma Jun 02, 2026
- Chapter 1517: ~Marking My Mother-in-Law’s Heart and Body~ Jun 02, 2026
- Chapter 1516: ~Becoming One With My Lovely and Heavenly Moth Jun 02, 2026
- Chapter 1515: ~Eating My Shy Mother-in-Law’s Cat~ Jun 02, 2026
- Chapter 1514: ~Drinking My Motherly Mother-in-Law’s Milk~ Jun 02, 2026
- Chapter 1513: Kissing My Dear Mother-in-Law~ Jun 02, 2026
- Chapter 1512: My Mother-in-law’s heart belong to me! Jun 02, 2026
- Chapter 1511: Mother who got trapped by her own daughter! Pa Jun 02, 2026
- Chapter 1510: Mother got trapped by her own daughter! Part-1 Jun 02, 2026
- Chapter 1509: Each one has their own stories and pains: Part Jun 02, 2026
- Chapter 1508: Each one has their own stories and pains: Part Jun 02, 2026
- Chapter 1507: When Mother-in-law’s Past Pain and Love Bleeds Jun 02, 2026
- Chapter 1506: When Mother-in-law’s Past Pain and Love Bleeds Jun 02, 2026
- Chapter 1505: You are a selfish fking bastard! Jun 02, 2026
- Chapter 1504: Chad... is seducing Aether? Part-2 Jun 02, 2026
- Chapter 1503: Chad... is seducing Aether? Part-1 Jun 02, 2026
- Chapter 1502: Kaelith and Chad’s Marriage: Part-2 Jun 02, 2026
- Chapter 1501: Kaelith and Chad’s Marriage: Part-1 Jun 02, 2026
- Chapter 1500: Son-in-law’s gift for his Father-in-law’s Marr Jun 02, 2026
- Chapter 1499: I need a… bug Jun 02, 2026
- Chapter 1498: Talking to Mareth Jun 02, 2026
- Chapter 1497: Say… are you trying to seduce her? Jun 02, 2026
- Chapter 1496: It was time... Time for some bullshit~ Jun 02, 2026
- Chapter 1495: We’re hypocrites, Dora Jun 02, 2026
- Chapter 1494: You have to close your heart to protect what y Jun 02, 2026
- Chapter 1493: Give him an inch, and he goes miles... Fk You! Jun 02, 2026
- Chapter 1492: His Chance to Hold The Holy Grail Jun 02, 2026
- Chapter 1491: ~You’re supposed to misbehave, My Sexy Wolfy: Jun 02, 2026
- Chapter 1490: ~You’re supposed to misbehave, My Sexy Wolfy: Jun 02, 2026
- Chapter 1489: ~You’re supposed to misbehave, My Sexy Wolfy: Jun 02, 2026
- Chapter 1488: I think… I turned on Jun 02, 2026
- Chapter 1487: ~P-Please don’t leave me again… I… I was so sc Jun 02, 2026
- Chapter 1486: ~P-Please don’t leave me again… I… I was so sc Jun 02, 2026
- Chapter 1485: Argh! FK YOU, NIGHTFIRE!! Jun 02, 2026
- Chapter 1484: Vesperine making a deal Jun 02, 2026
- Chapter 1483: Everyone is grown up... except Nightfire Jun 02, 2026
- Chapter 1482: Delphine getting murdered? Jun 02, 2026
- Chapter 1481: Ending the Ritual Jun 02, 2026
- Chapter 1480: When Happiness turned to Fear and Death: Part- Jun 02, 2026
- Chapter 1479: When Happiness turned to Fear and Death: Part- Jun 02, 2026
- Chapter 1478: Official Engagement of Aerionis Zephyra: Part- Jun 02, 2026
- Chapter 1477: Official Engagement of Aerionis Zephyra: Part- Jun 02, 2026
- Chapter 1476: Official Engagement of Aerionis Zephyra: Part- Jun 02, 2026
- Chapter 1475: Official Engagement of Aerionis Zephyra: Part- Jun 02, 2026
- Chapter 1474: Official Engagement of Aerionis Zephyra: Part- Jun 02, 2026
- Chapter 1473: I am Aether... But I don’t have a dk. Hahaha! Jun 02, 2026
- Chapter 1472: What if Aether actually clapped the Prophetess Jun 02, 2026
- Chapter 1471: """""SHIT!!!!!""""" Jun 02, 2026
- Chapter 1470: A Ring that meant... Past, Present and Future Jun 02, 2026
- Chapter 1469: ~Don’t worry she would take care of him: Part- Jun 02, 2026
- Chapter 1468: ~Don’t worry she would take care of him: Part- Jun 02, 2026
- Chapter 1467: Don’t worry she would take care of him: Part-1 Jun 02, 2026
- Chapter 1466: A Path of Death had chosen! Jun 02, 2026
- Chapter 1465: “Will you marry me?” Jun 02, 2026
- Chapter 1464: Activating Null-Return Jun 02, 2026
- Chapter 1463: Cooking Competition... Guess who won? Part-2 Jun 02, 2026
- Chapter 1462: Cooking Competition... Guess who won? Part-1 Jun 02, 2026
- Chapter 1461: Both Scientist were working deeply! Jun 02, 2026
- Chapter 1460: Getting Details? Haha... She could do better! Jun 02, 2026
- Chapter 1459: Getting Details? Haha... She could do better! Jun 02, 2026
- Chapter 1458: Do you know what Torture is? Part-2 Jun 02, 2026
- Chapter 1457: Do you know what Torture is? Part-1 Jun 02, 2026
- Chapter 1456: He had just faced death... only to see it agai Jun 02, 2026
- Chapter 1455: Everyone will receive his love! Jun 02, 2026
- Chapter 1454: Food taste better when you hungry! Jun 02, 2026
- Chapter 1453: "Who... are you?" Jun 02, 2026
- Chapter 1452: Who… are you? Jun 02, 2026
- Chapter 1451: Remember this... If you do not kill her, YOU. Jun 02, 2026
- Chapter 1450: You lose control of your emotions so easily wh Jun 02, 2026
- Chapter 1449: Please… that is all this woman can give you. P Jun 02, 2026
- Chapter 1448: Come on, ladies... There’s no point hiding it Jun 02, 2026
- Chapter 1447: On the way... nothing happened? Jun 02, 2026
- Chapter 1446: Curse? Fu*k off! Jun 02, 2026
- Chapter 1445: F-For everything… P-Please don’t leave me agai Jun 02, 2026
- Chapter 1444: H-He is… cursed! Jun 02, 2026
- Chapter 1443: Capturing It Jun 02, 2026
- Chapter 1442: It’s just Matter of seconds! Jun 02, 2026
- Chapter 1441: Do you think you can defeat me, bih! Jun 02, 2026
- Chapter 1440: You must be out before the next barrier solidi Jun 02, 2026
- Chapter 1439: Do you really think you can escape from me, yo Jun 02, 2026
- Chapter 1438: Forced sisters.... And natural friends Jun 02, 2026
- Chapter 1437: How dare they think little of Nightfire! Hmph! Jun 02, 2026
- Chapter 1436: We caught a live metallic figure! Jun 02, 2026
- Chapter 1435: A shoulder that pulled her back when she stood Jun 02, 2026
- Chapter 1434: Aether… he was really worried about you, you k Jun 02, 2026
- Chapter 1433: I am so proud of you, darling… so very proud Jun 02, 2026
- Chapter 1432: It’s been a while... Ex-Arcane King! Jun 02, 2026
- Chapter 1431: A temporary replacement, synchronised with the Jun 02, 2026
- Chapter 1430: Then we have no choice but to declare all-out Jun 02, 2026
- Chapter 1429: Maybe... he did not want to exploit her feelin Jun 02, 2026
- Chapter 1428: [Bonus] If she did not do it… Then who placed Jun 02, 2026
- Chapter 1427: Yes. It shouldn’t be possible. But Jun 02, 2026
- Chapter 1426: I… I love you… A-Aether Jun 02, 2026
- Chapter 1425: Sometimes... I cannot let you go even if you l Jun 02, 2026
- Chapter 1424: Sorry for the delay... It took some time to ca Jun 02, 2026
- Chapter 1423: Friendly Neighbourhood Mother to... Bitchy Nei Jun 02, 2026
- Chapter 1422: When fate itself wanted to hide him from her! Jun 02, 2026
- Chapter 1421: Vyn teymai ishkar en Vel’Araeyn, ee thaemar la Jun 02, 2026
- Chapter 1420: In the end... I truly have nothing but pain to Jun 02, 2026
- Chapter 1419: Good... bye Jun 02, 2026
- Chapter 1418: You lied to me… AGAIN!!!!! Jun 02, 2026
- Chapter 1417: I… never deserved you Jun 02, 2026
- Chapter 1416: S-She broke up with me… left me for the pain I Jun 02, 2026
- Chapter 1415: Avoid as much as you want… like the time you b Jun 02, 2026
- Chapter 1414: He is a cursed child Jun 02, 2026
- Chapter 1413: Oh, Darling, you so~ sly bastard~ playing game Jun 02, 2026
- Chapter 1412: Awweee… I love you so much, darling! Jun 02, 2026
- Chapter 1411: Arrh… it feels painful… arrh… I am going insan Jun 02, 2026
- Chapter 1410: A-Aether… sniff…A-Aether… please Jun 02, 2026
- Chapter 1409: Aether, please answer me properly Jun 02, 2026
- Chapter 1408: Why can’t you just give me the truth already, Jun 02, 2026
- Chapter 1407: I know it is really hard for you… But don’t wo Jun 02, 2026
- Chapter 1406: I don’t care anymore… go and fk whoever you wa Jun 02, 2026
- Chapter 1405: I get it… let me out… I understand… her pain n Jun 02, 2026
- Chapter 1404: She made her choice and… I accept it! Jun 02, 2026
- Chapter 1403: Blood is what unites us, and it is what gives Jun 02, 2026
- Chapter 1402: This is the only choice I have… Sorry… sorry Jun 02, 2026
- Chapter 1401: Let’s stop this, Aether… let’s… end this Jun 02, 2026
- Chapter 1400: She wasn’t just betrayed... She... She was utt Jun 02, 2026
- Chapter 1399: I hate him, right? [Bonus] Jun 02, 2026
- Chapter 1398: I love him, right? Jun 02, 2026
- Chapter 1397: "Can we talk, Del?" Jun 02, 2026
- Chapter 1396: Rosavere made a deal with devil! Jun 02, 2026
- Chapter 1395: Shall we talk, Aether?~ Jun 02, 2026
- Chapter 1394: School Days are the Best! Jun 02, 2026
- Chapter 1393: Origin Core Crystals Jun 02, 2026
- Chapter 1392: Rosavere... hiding something Jun 02, 2026
- Chapter 1391: Calming Down Hidden Bride?~ Jun 02, 2026
- Chapter 1390: Aether really getting good at S*X!~ Jun 02, 2026
- Chapter 1389: ~Calming Down Both Engaged Brides?~ Jun 02, 2026
- Chapter 1388: Vesperine getting stronger to put Aether betwe Jun 02, 2026
- Chapter 1387: Official Engagement of Aquaris Naiadae: Part-4 Jun 02, 2026
- Chapter 1386: Official Engagement of Aquaris Naiadae: Part-3 Jun 02, 2026
- Chapter 1385: Official Engagement of Aquaris Naiadae: Part-2 Jun 02, 2026
- Chapter 1384: Official Engagement of Aquaris Naiadae: Part-1 Jun 02, 2026
- Chapter 1383: Incendra Rut... A unique skill~ Jun 02, 2026
- Chapter 1382: He got the skill... but at what cost? Jun 02, 2026
- Chapter 1381: ~Both Beasts Fighting for Dominance?~ Jun 02, 2026
- Chapter 1380: ~Aether Got Rap*d... Hell Yeah!~ Jun 02, 2026
- Chapter 1379: ~Taming the Haughty/Horny Phoenix: Part-5~ Jun 02, 2026
- Chapter 1378: ~Taming the Haughty/Horny Phoenix: Part-4~ Jun 02, 2026
- Chapter 1377: ~Taming the Haughty/Horny Phoenix: Part-3~ Jun 02, 2026
- Chapter 1376: ~Taming the Haughty/Horny Phoenix: Part-2~ Jun 02, 2026
- Chapter 1375: ~Taming the Haughty/Horny Phoenix: Part-1~ Jun 02, 2026
- Chapter 1374: The phoenix comes to the dragon. Not the other Jun 02, 2026
- Chapter 1373: The phoenix comes to the dragon. Not the other Jun 02, 2026
- Chapter 1372: Phoenix Rut... It’s Mating Time! Jun 02, 2026
- Chapter 1371: Those curved peaches… those bubbles… that’s de Jun 02, 2026
- Chapter 1370: Making Thalia Rowdy again: Part-4 Jun 02, 2026
- Chapter 1369: Making Thalia Rowdy again: Part-3 Jun 02, 2026
- Chapter 1368: Making Thalia Rowdy again: Part-2 Jun 02, 2026
- Chapter 1367: Making Thalia Rowdy again: Part-1 Jun 02, 2026
- Chapter 1366: Am I… truly the one you need? Jun 02, 2026
- Chapter 1365: Maybe I am not special? Jun 02, 2026
- Chapter 1364: His world... is actually Earth? Jun 02, 2026
- Chapter 1363: Aether found another clue? Jun 02, 2026
- Chapter 1362: Emberlyn... can speak too! Jun 02, 2026
- Chapter 1361: Rosavere involved with Mary? Jun 02, 2026
- Chapter 1360: It’s a date, right? Jun 02, 2026
- Chapter 1359: Rosavere involved with Terra? Jun 02, 2026
- Chapter 1358: Sisters Failed to Prove Aether wrong: Part-2 Jun 02, 2026
- Chapter 1357: Sisters Failed to Prove Aether wrong: Part-1 Jun 02, 2026
- Chapter 1356: Pissing off Lyirrs is good? Jun 02, 2026
- Chapter 1355: Sisters on duty! Jun 02, 2026
- Chapter 1354: I think… we finally found what T.P. means Jun 02, 2026
- Chapter 1353: Engagements in week? Jun 02, 2026
- Chapter 1352: Something is happening: Part-2 Jun 02, 2026
- Chapter 1351: Something is happening: Part-1 Jun 02, 2026
- Chapter 1350: Lackey’s Origin Card Jun 02, 2026
- Chapter 1349: Please Show me your Origin Card, Mr. Lackey Jun 02, 2026
- Chapter 1348: ~Giving Reward to Nightfire’s Hard work: Part- Jun 02, 2026
- Chapter 1347: Giving Reward to Nightfire’s Hard work: Part-4 Jun 02, 2026
- Chapter 1346: Giving Reward to Nightfire’s Hard work: Part-3 Jun 02, 2026
- Chapter 1345: Giving Reward to Nightfire’s Hard work: Part-2 Jun 02, 2026
- Chapter 1344: Giving Reward to Nightfire’s Hard work: Part-1 Jun 02, 2026
- Chapter 1343: Two Empires Transporting Raw Materials? Jun 02, 2026
- Chapter 1342: Both Made for each other? Mary and Victor? Rea Jun 02, 2026
- Chapter 1341: Do you really believe the trial is only for th Jun 02, 2026
- Chapter 1340: Give up, Nightfire? Jun 02, 2026
- Chapter 1339: The Bait get Caught: Part-1 Jun 02, 2026
- Chapter 1338: [Please read Part-1 First. Mistakenly Posted] Jun 02, 2026
- Chapter 1337: Spying Void Empire: Part-3 Jun 02, 2026
- Chapter 1336: Spying Void Empire: Part-2 Jun 02, 2026
- Chapter 1335: Spying Void Empire: Part-1 Jun 02, 2026
- Chapter 1334: Again Nightfire as a bait?: Part-2 Jun 02, 2026
- Chapter 1333: Again Nightfire as a bait?: Part-1 Jun 02, 2026
- Chapter 1332: Those words... changed? Jun 02, 2026
- Chapter 1331: Grenthollow obliterates all souls Jun 02, 2026
- Chapter 1330: ~Nyx Trying her Best to have Baby: Part-3~ Jun 02, 2026
- Chapter 1329: ~Nyx Trying her Best to have Baby: Part-2~ Jun 02, 2026
- Chapter 1328: ~Nyx Trying her Best to have Baby: Part-1~ Jun 02, 2026
- Chapter 1327: Ancient Dragon Jun 02, 2026
- Chapter 1326: Freaking... Dk? Jun 02, 2026
- Chapter 1325: Again... That white haired man? Jun 02, 2026
- Chapter 1324: Starla... is useless sometimes! Jun 02, 2026
- Chapter 1323: A small talk between Mother-in-law and Son-in- Jun 02, 2026
- Chapter 1322: A small talk between Mother-in-law and Son-in- Jun 02, 2026
- Chapter 1321: Dealing with Inflation Jun 02, 2026
- Chapter 1320: Things were not going as he expected? Jun 02, 2026
- Chapter 1319: Real Value of our Arcaneless body Jun 02, 2026
- Chapter 1318: The New Information Jun 02, 2026
- Chapter 1317: At this rate… do I ever get some~some in my li Jun 02, 2026
- Chapter 1316: What the fuck?!! Jun 02, 2026
- Chapter 1315: Their mothers as well? Jun 02, 2026
- Chapter 1314: With the Princesses, the Saintess, and, appare Jun 02, 2026
- Chapter 1313: Official Engagement of Aether Jun 02, 2026
- Chapter 1312: Elder’s Wise words! Jun 02, 2026
- Chapter 1311: Making Aether guilty: Part-4 Jun 02, 2026
- Chapter 1310: Making Aether guilty: Part-3 Jun 02, 2026
- Chapter 1309: Making Aether guilty: Part-2 Jun 02, 2026
- Chapter 1308: Making Aether guilty: Part-1 Jun 02, 2026
- Chapter 1307: When New Emperor Plays Game: Part-2 Jun 02, 2026
- Chapter 1306: When New Emperor Plays Game: Part-1 Jun 02, 2026
- Chapter 1305: When Innocent Saintess Plays game: Part-2 Jun 02, 2026
- Chapter 1304: When Innocent Saintess Plays game: Part-1 Jun 02, 2026
- Chapter 1303: We need Aether: Part-2 Jun 02, 2026
- Chapter 1302: We need Aether: Part-1 Jun 02, 2026
- Chapter 1301: My lovely husbands… loves me so much Jun 02, 2026
- Chapter 1300: I hereby announce my engagement with Aether, t Jun 02, 2026
- Chapter 1299: Terrorizing Empires: Part-2 Jun 02, 2026
- Chapter 1298: Terrorizing Empires: Part-1 Jun 02, 2026
- Chapter 1297: Calming Empires: Part-2 Jun 02, 2026
- Chapter 1296: Calming Empires: Part-1 Jun 02, 2026
- Chapter 1295: Empires Falling Apart: Part-2 Jun 02, 2026
- Chapter 1294: Empires Falling Apart: Part-1 Jun 02, 2026
- Chapter 1293: I guess it’s time for it, right, Mom? Jun 02, 2026
- Chapter 1292: Origin Cards? Jun 02, 2026
- Chapter 1291: “So this is the beginning, ah…?” Jun 02, 2026
- Chapter 1290: Welcome to… THE BEGINNING Jun 02, 2026
- Chapter 1289: His women were his pride! Jun 02, 2026
- Chapter 1288: This bastard really was pissed off and showing Jun 02, 2026
- Chapter 1287: Blood is thicker than water Jun 02, 2026
- Chapter 1286: You’re a new species... A Progenitor! Jun 02, 2026
- Chapter 1285: Shocking yet.... actual truth! Jun 02, 2026
- Chapter 1284: That thing… is not what you think it is. He is Jun 02, 2026
- Chapter 1283: It’s Time for More Blood... Nope! Jun 02, 2026
- Chapter 1282: Ninety percent completed~ Jun 02, 2026
- Chapter 1281: Bloody Mary... is not just a name! Part-2 Jun 02, 2026
- Chapter 1280: Bloody Mary... is not just a name! Part-1 Jun 02, 2026
- Chapter 1279: First Miracle: Part-2 Jun 02, 2026
- Chapter 1278: First Miracle: Part-1 Jun 02, 2026
- Chapter 1277: Xara-Mary’s Deals! Part-3 Jun 02, 2026
- Chapter 1276: Xara-Mary’s Deals! Part-2 Jun 02, 2026
- Chapter 1275: Xara-Mary’s Deals! Part-1 Jun 02, 2026
- Chapter 1274: I love… the woman you are, not the mask you we Jun 02, 2026
- Chapter 1273: Getting two more sisters soured their mood Jun 02, 2026
- Chapter 1272: What? Morgana is Alucard’s D Jun 02, 2026
- Chapter 1271: I need information… in exchange for this Jun 02, 2026
- Chapter 1270: Empress Mary’s late husband, Alucard Jun 02, 2026
- Chapter 1269: Aether or Victor. Oh, Jolly~Golly! Jun 02, 2026
- Chapter 1268: Remaining Time: 00 days 00 hours 00 minutes 01 Jun 02, 2026
- Chapter 1267: Block the Arcane Jun 02, 2026
- Chapter 1266: Activate Project ‘X’ Jun 02, 2026
- Chapter 1265: Remaining Time: 00 days 24 hours 60 minutes 60 Jun 02, 2026
- Chapter 1264: Being a Sovereign… is not easy Jun 02, 2026
- Chapter 1263: We’re about to get fucked again!! Jun 02, 2026
- Chapter 1262: Let’s Hope for the Best! Jun 02, 2026
- Chapter 1261: That freaking Fox... toyed with him!!~ Jun 02, 2026
- Chapter 1260: The next phase is ready… should we? Jun 02, 2026
- Chapter 1259: Thrown out of Void Empire Jun 02, 2026
- Chapter 1258: Looks like we are Jun 02, 2026
- Chapter 1257: The Beginning = The Origins Jun 02, 2026
- Chapter 1256: There are... Empires? [Bonus] Jun 02, 2026
- Chapter 1255: Oops… you found me Jun 02, 2026
- Chapter 1254: It’s me. Your boyfriend, Aether Jun 02, 2026
- Chapter 1253: Who? I’ve never heard that name before Jun 02, 2026
- Chapter 1252: You’ll all pay for this Jun 02, 2026
- Chapter 1251: Clarion? Jun 02, 2026
- Chapter 1250: Snowflake dead? Jun 02, 2026
- Chapter 1249: Finding his Loved ones: Part-4 Jun 02, 2026
- Chapter 1248: Finding his Loved ones: Part-3 Jun 02, 2026
- Chapter 1247: Finding his Loved ones: Part-2 Jun 02, 2026
- Chapter 1246: Finding his Loved ones: Part-1 Jun 02, 2026
- Chapter 1245: Remaining Time: 17 days 01 hours 31 minutes 52 Jun 02, 2026
- Chapter 1244: Snowflake Kidnapped too? Jun 02, 2026
- Chapter 1243: Lia got Kidnapped! Jun 02, 2026
- Chapter 1242: A New Enemy? Jun 02, 2026
- Chapter 1241: Welcome... The Origins! Jun 02, 2026
- Chapter 1240: Welcome back... Snape! Jun 02, 2026
- Chapter 1239: MADNESS VS MADNESS Jun 02, 2026
- Chapter 1238: Madness Vs Madness: Part-2 Jun 02, 2026
- Chapter 1237: Madness vs Madness: Part-1 Jun 02, 2026
- Chapter 1236: Don’t act so surprised, Aether… or should I ca Jun 02, 2026
- Chapter 1235: Well, He kind of took over the Empire? Jun 02, 2026
- Chapter 1234: Paralyzing Effect Neutralized! Jun 02, 2026
- Chapter 1233: Confusion? Shock? Surprise? Jun 02, 2026
- Chapter 1232: After all… someone close to you is going to be Jun 02, 2026
- Chapter 1231: Go on… kill me~ Jun 02, 2026
- Chapter 1230: Let’s erase his existence! Hehehe~ Jun 02, 2026
- Chapter 1229: Isn’t that right? …Morgana? Jun 02, 2026
- Chapter 1228: Hello, Mary Jun 02, 2026
- Chapter 1227: Truth of his Affection Points Jun 02, 2026
- Chapter 1226: Aether got Arrested! Jun 02, 2026
- Chapter 1225: By order of Her Imperial Majesty, Aether shall Jun 02, 2026
- Chapter 1224: Threshold Broken → You have ascended to Level Jun 02, 2026
- Chapter 1223: Aether made her cry, Man? Why man? Jun 02, 2026
- Chapter 1222: Aether? Aether? Really? Jun 02, 2026
- Chapter 1221: Just One Second is Enough! Jun 02, 2026
- Chapter 1220: That was all I saw before everything… was cove Jun 02, 2026
- Chapter 1219: A girl who wanted to Pampered: Part-2 Jun 02, 2026
- Chapter 1218: A girl who wanted to Pampered: Part-1 [Bonus] Jun 02, 2026
- Chapter 1217: So… I’m the one forcing this? Jun 02, 2026
- Chapter 1216: Please… come back Jun 02, 2026
- Chapter 1215: Taking... Grenthollow: Part-2 Jun 02, 2026
- Chapter 1214: Taking... Grenthollow: Part-1 Jun 02, 2026
- Chapter 1213: Because… You love her. She died! [Bonus] Jun 02, 2026
- Chapter 1212: Current Pseudo Owner of the Eternal Contract i Jun 02, 2026
- Chapter 1211: Sneaky~ Sneak~ Sneaky~ Sneak~ Jun 02, 2026
- Chapter 1210: Eternal Contract On the Verge of Termination: Jun 02, 2026
- Chapter 1209: Eternal Contract On the Verge of Termination: Jun 02, 2026
- Chapter 1208: ~This Time Not bad~ Jun 02, 2026
- Chapter 1207: This Time Not bad~ Jun 02, 2026
- Chapter 1206: Make Love to you? Nyx Seriously? Jun 02, 2026
- Chapter 1205: It’s time... to start his game! Jun 02, 2026
- Chapter 1204: New Master of Arcane Hunter Organization: Part Jun 02, 2026
- Chapter 1203: New Master of Arcane Hunter Organization: Part Jun 02, 2026
- Chapter 1202: Modified Project-X Jun 02, 2026
- Chapter 1201: His Poor Snowflake was Purified! Jun 02, 2026
- Chapter 1200: That Thing… belongs to me. Understood? Jun 02, 2026
- Chapter 1199: Nah, Bro! Jun 02, 2026
- Chapter 1198: Aether got laid by Vesperine? Jun 02, 2026
- Chapter 1197: Please, give me a chance! I-I really did love Jun 02, 2026
- Chapter 1196: Meeting his son again! Jun 02, 2026
- Chapter 1195: Who is Vesperine? Jun 02, 2026
- Chapter 1194: Victor, The violent storm and Aether, The gent Jun 02, 2026
- Chapter 1193: His Wives did not follow him blindly Jun 02, 2026
- Chapter 1192: ~Night is on Fire: Part-5~ Jun 02, 2026
- Chapter 1191: ~Night is on Fire: Part-4~ Jun 02, 2026
- Chapter 1190: ~Night is on Fire: Part-3~ Jun 02, 2026
- Chapter 1189: ~Night is on Fire: Part-2~ Jun 02, 2026
- Chapter 1188: Night is on Fire: Part-1~ Jun 02, 2026
- Chapter 1187: Trinity Jun 02, 2026
- Chapter 1186: If this is what people call… Love. Then Yeah, Jun 02, 2026
- Chapter 1185: Do you love me.... Nightfire?: Part-2 Jun 02, 2026
- Chapter 1184: Do you love me.... Nightfire?: Part-1 Jun 02, 2026
- Chapter 1183: Nightfire is in Love? Really? A Succubus? Jun 02, 2026
- Chapter 1182: You’re the worst I’ve ever received Jun 02, 2026
- Chapter 1181: Nightfire finally getting what she wanted! Jun 02, 2026
- Chapter 1180: Mary had just gone completely mad Jun 02, 2026
- Chapter 1179: Mary Never hated Aether... for real? Jun 02, 2026
- Chapter 1178: Lia and Mary’s First Family Fight! Jun 02, 2026
- Chapter 1177: Lia’s First time and Thoughts! Jun 02, 2026
- Chapter 1176: She had just caught her husband cheating Jun 02, 2026
- Chapter 1175: Lia is... Mother-con? Part-2 Jun 02, 2026
- Chapter 1174: Lia is... Mother-con? Part-1 Jun 02, 2026
- Chapter 1173: Your soul...? No. From the beginning, it was n Jun 02, 2026
- Chapter 1172: Want to learn how to fight against the souls? Jun 02, 2026
- Chapter 1171: The Grace and Mary hated each other Jun 02, 2026
- Chapter 1170: Restarting The Grenthollow: Part-2 Jun 02, 2026
- Chapter 1169: Restarting The Grenthollow: Part-1 Jun 02, 2026
- Chapter 1168: What happened after the ceremony? Part-2 Jun 02, 2026
- Chapter 1167: What happened after the ceremony? Part-1 Jun 02, 2026
- Chapter 1166: Mending the Broken Samsara: Part-6 Jun 02, 2026
- Chapter 1165: Mending the Broken Samsara: Part-5 Jun 02, 2026
- Chapter 1164: Mending the Broken Samsara: Part-4 Jun 02, 2026
- Chapter 1163: Mending the Broken Samsara: Part-3 Jun 02, 2026
- Chapter 1162: Mending the Broken Samsara: Part-2 Jun 02, 2026
- Chapter 1161: Mending the Broken Samsara: Part-1 Jun 02, 2026
- Chapter 1160: OH MY GOD! WHAT A LOVE!! Aether sacrificed him Jun 02, 2026
- Chapter 1159: Broken Samsara: Part-4 Jun 02, 2026
- Chapter 1158: Broken Samsara: Part-3 Jun 02, 2026
- Chapter 1157: Broken Samsara: Part-2 Jun 02, 2026
- Chapter 1156: Broken Samsara: Part-1 Jun 02, 2026
- Chapter 1155: Echoes Between Life and Death Jun 02, 2026
- Chapter 1154: He is indeed... my husband Jun 02, 2026
- Chapter 1153: Capturing The Grace! Jun 02, 2026
- Chapter 1152: Nyx Shadowfall’s True Face: Part-3 [Bonus] Jun 02, 2026
- Chapter 1151: Nyx Shadowfall’s True Face: Part-2 Jun 02, 2026
- Chapter 1150: Nyx Shadowfall’s True Face: Part-1 Jun 02, 2026
- Chapter 1149: This was true damnation... Welcome to the Umbr Jun 02, 2026
- Chapter 1148: Looks like Blood is happening way too often th Jun 02, 2026
- Chapter 1147: Nyx Shadowfall is Not Normal: Part-1 Jun 02, 2026
- Chapter 1146: Rule 1: Sex is optional Jun 02, 2026
- Chapter 1145: What’s wrong with this people? Jun 02, 2026
- Chapter 1144: Teaching Nightfire who is the real Master~ Jun 02, 2026
- Chapter 1143: Nightfire... Playing with Fire! Jun 02, 2026
- Chapter 1142: Sorry, I already like someone Jun 02, 2026
- Chapter 1141: ~A boring First Night~ [Bonus] Jun 02, 2026
- Chapter 1140: ~Divorce Counselling Part-3~ Jun 02, 2026
- Chapter 1139: Divorce Counselling Part-2~ Jun 02, 2026
- Chapter 1138: Mother’s tingle? Jun 02, 2026
- Chapter 1137: Divorce Counselling Part-1 Jun 02, 2026
- Chapter 1136 1136: Aether got Divorce? [Bonus] Jun 02, 2026
- Chapter 1135: Marriage is scary Jun 02, 2026
- Chapter 1134: Aether got Married: Part-2 Jun 02, 2026
- Chapter 1133: Aether got Married: Part-1 Jun 02, 2026
- Chapter 1132: ##### Part-4 Jun 02, 2026
- Chapter 1131: ##### Part-3 Jun 02, 2026
- Chapter 1130: ##### Part-2 Jun 02, 2026
- Chapter 1129: ##### Part-1 Jun 02, 2026
- Chapter 1128: Aether got Kidnapped Jun 02, 2026
- Chapter 1127: My cute little puppy Jun 02, 2026
- Chapter 1126: Finally, without any interruption Jun 02, 2026
- Chapter 1125: Please don’t fight Jun 02, 2026
- Chapter 1124: Both Son and Father... FU## Jun 02, 2026
- Chapter 1123: The Ruler chosen by people Jun 02, 2026
- Chapter 1122: I’m the one who has to face her Jun 02, 2026
- Chapter 1121: Family Talk Jun 02, 2026
- Chapter 1120: Girls Talk Jun 02, 2026
- Chapter 1119: Sitting on the Frozen Throne: Part-2 Jun 02, 2026
- Chapter 1118: Sitting on the Frozen Throne: Part-1 Jun 02, 2026
- Chapter 1117: Choosing The Ruler: Part-4 Jun 02, 2026
- Chapter 1116: Choosing The Ruler: Part-3 Jun 02, 2026
- Chapter 1115: Choosing The Ruler: Part-2 Jun 02, 2026
- Chapter 1114: Choosing The Ruler: Part-1 Jun 02, 2026
- Chapter 1113: Milking Xara: Part-2~ Jun 02, 2026
- Chapter 1112: Milking Xara: Part-1 Jun 02, 2026
- Chapter 1111: Curing the Children: Part-2 Jun 02, 2026
- Chapter 1110: Curing the Children: Part-1 Jun 02, 2026
- Chapter 1109: Tragedy and Grief Jun 02, 2026
- Chapter 1108: The Winner of the Third Trial is Jun 02, 2026
- Chapter 1107: End of Third Trial: Part-4 Jun 02, 2026
- Chapter 1106: End of Third Trial: Part-3 Jun 02, 2026
- Chapter 1105: End of Third Trial: Part-2 Jun 02, 2026
- Chapter 1104: End of Third Trial: Part-1 Jun 02, 2026
- Chapter 1103: My name is Aether... Archpriest Aether Jun 02, 2026
- Chapter 1102: A Normal life of Every working man! Jun 02, 2026
- Chapter 1101: ~Naughty Saintess: Part-2~ Jun 02, 2026
- Chapter 1100: ~Naughty Saintess: Part-1~ Jun 02, 2026
- Chapter 1099: Found you, Final... One Piece. [Bonus GT:100(´ Jun 02, 2026
- Chapter 1098: ~She had crossed the edge~ Jun 02, 2026
- Chapter 1097: ~I want to become one with you~ Jun 02, 2026
- Chapter 1096: You’re mine... I want it all~ Jun 02, 2026
- Chapter 1095: I promise on my soul Jun 02, 2026
- Chapter 1094: Let's end this, Aether Jun 02, 2026
- Chapter 1093 1093: Looks like you finally decided... Huh? Jun 02, 2026
- Chapter 1092 1092: Aether's Weapon? Jun 02, 2026
- Chapter 1091 1091: He sacrificed his dignity for us Jun 02, 2026
- Chapter 1090 1090: Aria accepts Her Mother's Love Jun 02, 2026
- Chapter 1089 1089: He treats everyone Equally! Jun 02, 2026
- Chapter 1088: Dad-Son Talk Jun 02, 2026
- Chapter 1087: He’s asking for me? Not... this woman? Jun 02, 2026
- Chapter 1086: Sometimes… maybe Snakes too understand woman?: Jun 02, 2026
- Chapter 1085: Sometime Only woman can understand another wom Jun 02, 2026
- Chapter 1084: Sometime Only woman can understand another wom Jun 02, 2026
- Chapter 1083: Aether being genuine to Delphine Jun 02, 2026
- Chapter 1082: He loves them Equally Jun 02, 2026
- Chapter 1081: ~The Ultra Deep Pro MaXer: Part-3~ Jun 02, 2026
- Chapter 1080: ~The Ultra Deep Pro MaXer: Part-2~ Jun 02, 2026
- Chapter 1079 1079: ~The Ultra Deep Pro MaXer: Part-1~ Jun 02, 2026
- Chapter 1078 1078: Massaging the Hard worker: Part-2~ Jun 02, 2026
- Chapter 1077 1077: Massaging the Hard worker: Part-1~ Jun 02, 2026
- Chapter 1076: Postpone the guilt, Please Jun 02, 2026
- Chapter 1075: She was possessed… by a ghost Jun 02, 2026
- Chapter 1074: Origin Pillars' Rising: Part-1 Jun 02, 2026
- Chapter 1073: But when it came to Kara Jun 02, 2026
- Chapter 1072: Aether... Baby Aether... Cute Aether Jun 02, 2026
- Chapter 1071: Your thighs didn’t use to be that... thicc Jun 02, 2026
- Chapter 1070: Project X Jun 02, 2026
- Chapter 1069: Sometimes... Even woman needs time Jun 02, 2026
- Chapter 1068: Exam of Thrones Jun 02, 2026
- Chapter 1067: Killing Dora: Part-4 Jun 02, 2026
- Chapter 1066: Killing Dora: Part-3 Jun 02, 2026
- Chapter 1065: Killing Dora: Part-2 Jun 02, 2026
- Chapter 1064: Killing Dora: Part-1 Jun 02, 2026
- Chapter 1063: I’ll give my life for my love... Can you take Jun 02, 2026
- Chapter 1062: He... kind of looks familiar Jun 02, 2026
- Chapter 1061: A Price he needs to pay Jun 02, 2026
- Chapter 1060: I am... Aether. The one and only Aether Jun 02, 2026
- Chapter 1059: You are not worthy… No.28 Jun 02, 2026
- Chapter 1058: The Seed has been Planted Jun 02, 2026
- Chapter 1057: Log... did tried to Help, honestly! Jun 02, 2026
- Chapter 1056: Broken Heart Helena Jun 02, 2026
- Chapter 1055: Becoming Archpriest Again? Jun 02, 2026
- Chapter 1054: Helena... was traumatized Jun 02, 2026
- Chapter 1053: Just Aether and Sera came~ Jun 02, 2026
- Chapter 1052: That’s one hell of a welcome Jun 02, 2026
- Chapter 1051: ~Needy Stella~ Jun 02, 2026
- Chapter 1050: ~Shy Stella~ Jun 02, 2026
- Chapter 1049: I’m gonna taste the best version of you now!! Jun 02, 2026
- Chapter 1048: Aether didn’t need to be called A God... Becau Jun 02, 2026
- Chapter 1047: Aether is... living God?... F* it! Jun 02, 2026
- Chapter 1046: ~Behind Mother’s Back: Part-3~ Jun 02, 2026
- Chapter 1045: ~Behind Mother’s Back: Part-2~ Jun 02, 2026
- Chapter 1044: ~Behind Mother’s Back: Part-1~ Jun 02, 2026
- Chapter 1043: If you're done dreaming... come see what you'v Jun 02, 2026
- Chapter 1042: Cute little Elephant? Nah... It's just sleepin Jun 02, 2026
- Chapter 1041: You dare call me pathetic? Jun 02, 2026
- Chapter 1040: Pathetic Jun 02, 2026
- Chapter 1039: Apostle VS Ex-Archpriest Jun 02, 2026
- Chapter 1038: Finnian Vs Aether Jun 02, 2026
- Chapter 1037: Scared of losing to a mere 'slave'? Jun 02, 2026
- Chapter 1036 1036: I give myself to someone Mother deems wor Jun 02, 2026
- Chapter 1035 1035: A Simple Date with Archpriestess: Aether Jun 02, 2026
- Chapter 1034 1034: A Simple Date with Archpriestess Jun 02, 2026
- Chapter 1033 1033: You’ve finally arrived Jun 02, 2026
- Chapter 1032 1032: ...Did you hear? There was a man... in th Jun 02, 2026
- Chapter 1031 1031: Sera couldn't get what she wanted and Aet Jun 02, 2026
- Chapter 1030 1030: Stella to Seraphina Jun 02, 2026
- Chapter 1029 1029: Archpriestess/Stella: Part-4 Jun 02, 2026
- Chapter 1028 1028: Archpriestess/Stella: Part-3 Jun 02, 2026
- Chapter 1027 1027: Archpriestess/Stella: Part-2 Jun 02, 2026
- Chapter 1026 1026: Archpriestess/Stella: Part-1 Jun 02, 2026
- Chapter 1025 1025: Aether made a deal for Thrusters! Jun 02, 2026
- Chapter 1024 1024: Mother just disrespected him!! Jun 02, 2026
- Chapter 1023 1023: Mother... is calling you Jun 02, 2026
- Chapter 1022: We don’t have enough funds Jun 02, 2026
- Chapter 1021: You really did miss me, didn’t you? Jun 02, 2026
- Chapter 1020: Visiting Elysiumis Aurora Empire Jun 02, 2026
- Chapter 1019: Victor was Traumatized Jun 02, 2026
- Chapter 1018: Cowardice and Fear... will be carved from hist Jun 02, 2026
- Chapter 1017: You are not my target, Xara Seraphine Jun 02, 2026
- Chapter 1016: Hehe.. It’s blood time, cuties Jun 02, 2026
- Chapter 1015: There’s a possibility I could cure those mutat Jun 02, 2026
- Chapter 1014: We are... currently lovers of the same Mighty Jun 02, 2026
- Chapter 1013: Welcome... to my humble abode Jun 02, 2026
- Chapter 1012: My man should always stand tall Jun 02, 2026
- Chapter 1011: Xara didn't mind Harem... really? Jun 02, 2026
- Chapter 1010: Aether... Give him to me, Mom! Jun 02, 2026
- Chapter 1009: Did you think I found you... repulsive? Jun 02, 2026
- Chapter 1008: I really Love him Jun 02, 2026
- Chapter 1007: Xara Made Different! Jun 02, 2026
- Chapter 1006: Both Vesperine and Aether wanted the same thin Jun 02, 2026
- Chapter 1005: Aether is wicked than Xara?: Part-2 Jun 02, 2026
- Chapter 1004: Aether is wicked than Xara?: Part-1 Jun 02, 2026
- Chapter 1003: Aether Saved Kai... Tsk! Jun 02, 2026
- Chapter 1002: Kai was killed? Jun 02, 2026
- Chapter 1001: Aether did... the right thing, right? Jun 02, 2026
- Chapter 1000: Broken Bond Jun 02, 2026
- Chapter 999: Vesperine Broke the Bond between Mother and Son Jun 02, 2026
- Chapter 998: Vesperine Broke the Bond between Mother and Son Jun 02, 2026
- Chapter 997: Vesperine Broke the Bond between Mother and Son Jun 02, 2026
- Chapter 996: Vesperine Broke the Bond between Mother and Son Jun 02, 2026
- Chapter 995: What happened inside the room? Jun 02, 2026
- Chapter 994: Xara Confronted Vesperine Jun 02, 2026
- Chapter 993: Vesperine… was a succubus? Jun 02, 2026
- Chapter 992: Honestly? I was hoping we could have some-some. Jun 02, 2026
- Chapter 991: Vesperine blackmailing Xara? Jun 02, 2026
- Chapter 990 990: Aether is Yandere? Of course, not... really Jun 02, 2026
- Chapter 989 989: I don’t mind polygyny, to be honest Jun 02, 2026
- Chapter 988 988: This is the woman I love—the one I want to Jun 02, 2026
- Chapter 987: See! See, Mother! I’m better than that slave yo Jun 02, 2026
- Chapter 986: To him, the meal before him was more important Jun 02, 2026
- Chapter 985: He’s totally bullying me!! Jun 02, 2026
- Chapter 984: Wait... I am forgetting something. Or... someon Jun 02, 2026
- Chapter 983: I know I was confused back then... Now, You are Jun 02, 2026
- Chapter 982: So all this time... everything I’ve done... I’v Jun 02, 2026
- Chapter 981: ...I am Slave to Gods? WHF!!! Jun 02, 2026
- Chapter 980: Vesperine is on the move Jun 02, 2026
- Chapter 979: If anyone dares to lie about bearing the child Jun 02, 2026
- Chapter 978 978: Trying to Fix that Never broken? Jun 02, 2026
- Chapter 977 977: The Truth is simple: She is not normal! Jun 02, 2026
- Chapter 976 976: You don’t have any illegitimate children, r Jun 02, 2026
- Chapter 975 975: I... have proof of his love Jun 02, 2026
- Chapter 974 974: All he could do was think... think about Xa Jun 02, 2026
- Chapter 973 973: I'm not... normal? Jun 02, 2026
- Chapter 972 972: I AM NOT NORMAL!! PLEASE LEAVE ME ALONE!!! Jun 02, 2026
- Chapter 971 971: Do you still like this... f###ed-up woman~? Jun 02, 2026
- Chapter 970: Insane Woman: Part-3 Jun 02, 2026
- Chapter 969: Insane Woman: Part-2 Jun 02, 2026
- Chapter 968: Insane Woman Part:1 Jun 02, 2026
- Chapter 967 967: Hehehehe~ F-F### m— Slap! Jun 02, 2026
- Chapter 966 966: Push me away if you want Jun 02, 2026
- Chapter 965 965: Our Origin Jun 02, 2026
- Chapter 964: Roses Jun 02, 2026
- Chapter 963: King of Woods Jun 02, 2026
- Chapter 962: Every woman was a battlefield Jun 02, 2026
- Chapter 961: I... kind of shoved it into her mother's ass Jun 02, 2026
- Chapter 960: Another 5 Days? Jun 02, 2026
- Chapter 959: What the F### is wrong with these women? Jun 02, 2026
- Chapter 958: ~She regretted for using her ASS~ Jun 02, 2026
- Chapter 957: ~The Truth... or The Ass~ which one do you want Jun 02, 2026
- Chapter 956: ~He was just getting started~ Jun 02, 2026
- Chapter 955: ~You taste so good when you're weak, Aether Dar Jun 02, 2026
- Chapter 954: I could lick this all night~ Jun 02, 2026
- Chapter 953: Love's Trident Jun 02, 2026
- Chapter 952: Aether... Will you Jun 02, 2026
- Chapter 951: Where is her Pu###? Jun 02, 2026
- Chapter 950: A Siren? Jun 02, 2026
- Chapter 949 949: Mom, you did this... So you can get pregnan Jun 02, 2026
- Chapter 948 948: Rated Insane Women in these worlds! Jun 02, 2026
- Chapter 947 947: Jealousy Princess is cute too! Jun 02, 2026
- Chapter 946: ~Tamed The Empress~ Jun 02, 2026
- Chapter 945: Purple Card? Jun 02, 2026
- Chapter 944: ~Empress is Horny~ Jun 02, 2026
- Chapter 943: Marking His Empress Jun 02, 2026
- Chapter 942: Even as a ghost, the Empress will still hunt yo Jun 02, 2026
- Chapter 941: Empress is scared of Death! Jun 02, 2026
- Chapter 940: ~Empress Played with Emperor's C###~ Jun 02, 2026
- Chapter 939: ~Empress Got Dominated? So what? She still try~ Jun 02, 2026
- Chapter 938: ~Empress wants to Dominate~ Jun 02, 2026
- Chapter 937: ~Claiming The Empress: Part-1~ Jun 02, 2026
- Chapter 936: Taming The Empress: Part-4~ Jun 02, 2026
- Chapter 935: Taming The Empress: Part-3~ Jun 02, 2026
- Chapter 934: Taming The Empress: Part-2 Jun 02, 2026
- Chapter 933: Taming The Empress: Part-1 Jun 02, 2026
- Chapter 932: Everything was ruled by the Primordial... Yet.. Jun 02, 2026
- Chapter 931: A Missing piece? Jun 02, 2026
- Chapter 930: ~Punishing Bad Girl: Part-4~ Jun 02, 2026
- Chapter 929: No Oyakodon...? NOOOOOO!!! Jun 02, 2026
- Chapter 928: ~Punishing Bad Man: Part-3~ Jun 02, 2026
- Chapter 927: ~Punishing Bad boy: Part-2~ Jun 02, 2026
- Chapter 923: Mending the Fractured Bond: Mother and Daughter Jun 02, 2026
- Chapter 922: Mending the Fractured Bond: Mother/Daughter Jun 02, 2026
- Chapter 921: There is more? Jun 02, 2026
- Chapter 926 926: Punishing Bad boy: Part-1~ Jun 02, 2026
- Chapter 925 925: Only the blood-marked may claim the Throne… Jun 02, 2026
- Chapter 924 924: The beginning: Fall of Naiadia Family Jun 02, 2026
- Chapter 920: I'm not going to forgive you! Jun 02, 2026
- Chapter 919: No choice but getting corrupted! Jun 02, 2026
- Chapter 918: He is telling Everything... Believe him! Jun 02, 2026
- Chapter 917: You’re more than fine then Jun 02, 2026
- Chapter 916: Waking up from Deep slumber! Jun 02, 2026
- Chapter 915: For it is only through death that one may recei Jun 02, 2026
- Chapter 914: Burn in Hell Jun 02, 2026
- Chapter 913: He was not getting into these Mess! Jun 02, 2026
- Chapter 912: We didn't do anything! I swear! Jun 02, 2026
- Chapter 911 911: Honest Mistake... He didn't really do anyth Jun 02, 2026
- Chapter 910 910: Archpriest Aether Jun 02, 2026
- Chapter 909 909: High Priest Aether Jun 02, 2026
- Chapter 908: Priest Aether Jun 02, 2026
- Chapter 907: Clerk Aether Jun 02, 2026
- Chapter 906: ~Treating the Drunken Man: Part-4~ Jun 02, 2026
- Chapter 905: Treating the Drunken Man: Part-3~ Jun 02, 2026
- Chapter 904: Treating the Drunken Man: Part-2 Jun 02, 2026
- Chapter 903: Treating the Drunken Man: Part-1 Jun 02, 2026
- Chapter 902: Don't play with Fox Jun 02, 2026
- Chapter 901: They Finally Know... Drunken Aether!! Part-8 Jun 02, 2026
- Chapter 900: They Finally Know... Drunken Aether!! Part-7 Jun 02, 2026
- Chapter 899: They Finally Know... Drunken Aether!! Part-6 Jun 02, 2026
- Chapter 898: They Finally Know... Drunken Aether!! Part-5~ Jun 02, 2026
- Chapter 897: They Finally Know... Drunken Aether!! Part-4~ Jun 02, 2026
- Chapter 896: They Finally Know... Drunken Aether!! Part-3 Jun 02, 2026
- Chapter 895: They Finally Know... Drunken Aether!! Part-2 Jun 02, 2026
- Chapter 894: They Finally Know... Drunken Aether!! Part-1 Jun 02, 2026
- Chapter 893: This night was about to become far more interes Jun 02, 2026
- Chapter 892: Kai Being Hunted!! Jun 02, 2026
- Chapter 891: A Light of her life! Jun 02, 2026
- Chapter 890 890: Good Man... Good Husband... Good Father Jun 02, 2026
- Chapter 889 889: The losers have to do anything I say Jun 02, 2026
- Chapter 888 888: Some answers are still missing Jun 02, 2026
- Chapter 887 887: Blood? That's all? Jun 02, 2026
- Chapter 886 886: Demi-God of Spirits Jun 02, 2026
- Chapter 885 885: Forbidden LOVE! Jun 02, 2026
- Chapter 884: Aether is Papa now! Jun 02, 2026
- Chapter 883: What the F### just happened here? Jun 02, 2026
- Chapter 882: Fu##! What have you done, Aether?: Part-4 Jun 02, 2026
- Chapter 881: Fu##! What have you done, Aether?: Part-3 Jun 02, 2026
- Chapter 880: Fu##! What have you done, Aether?: Part-2 Jun 02, 2026
- Chapter 879: Fu##! What have you done, Aether?: Part-1 Jun 02, 2026
- Chapter 878: Seducing Mother-in-law?.... WHAT THE HECK!! Jun 02, 2026
- Chapter 877 877: Mother-in-law cannot handle this kind of Pr Jun 02, 2026
- Chapter 876 876: When Mother-in-law becomes Mother: Part-3 Jun 02, 2026
- Chapter 875: When Mother-in-law becomes Mother: Part-2 Jun 02, 2026
- Chapter 874: When Mother-in-law becomes Mother: Part-1 Jun 02, 2026
- Chapter 873 873: Nice way to greet a Mother-in-law! Jun 02, 2026
- Chapter 872 872: Weird Targets? Jun 02, 2026
- Chapter 871 871: Found a Clue! Jun 02, 2026
- Chapter 870: Did you get it? Jun 02, 2026
- Chapter 869: Future Discussion and Secret Planning: Part-4 Jun 02, 2026
- Chapter 868: Future Discussion and Secret Planning: Part-3 Jun 02, 2026
- Chapter 867: Future Discussion and Secret Planning: Part-2 Jun 02, 2026
- Chapter 866: Future Discussion and Secret Planning: Part-1 Jun 02, 2026
- Chapter 865: Being both a Ruler and a Lover was truly a toug Jun 02, 2026
- Chapter 864: Pas(sed)t : Alaric Zephyr (A Chosen Man): Part- Jun 02, 2026
- Chapter 863: Pas(sed)t : Alaric Wood (A Longing boy): Part-1 Jun 02, 2026
- Chapter 862: The true danger approaching in the near future: Jun 02, 2026
- Chapter 861: The true danger approaching in the near future: Jun 02, 2026
- Chapter 860: The true danger approaching in the near future: Jun 02, 2026
- Chapter 859: Meeting The Grace for First time Jun 02, 2026
- Chapter 858 858: He had absolutely nothing to do with these Jun 02, 2026
- Chapter 857 857: She is a Mess Jun 02, 2026
- Chapter 856 856: Who is that Grace?.. That's why no one talk Jun 02, 2026
- Chapter 855: YOU WANTED THIS TO CONTINUE?! WELL, I’VE PERSON Jun 02, 2026
- Chapter 854: Maybe... Maybe not... Who knew? Jun 02, 2026
- Chapter 853: .... No one noticed! Jun 02, 2026
- Chapter 852 852: ... It was a smile of Victory... yet wicked Jun 02, 2026
- Chapter 851 851: The Victory.... Checkmate? Jun 02, 2026
- Chapter 850 850: Check: A Piece of Iteration No.25 Jun 02, 2026
- Chapter 849: Check: I knew it! Jun 02, 2026
- Chapter 848: Check: M-Mother... Give me one more chance Jun 02, 2026
- Chapter 847: Check: I am The Joker...? Part-4 Jun 02, 2026
- Chapter 846: Check: I am The Joker...? Part-2 Jun 02, 2026
- Chapter 845 845: Check: I am The Joker...? Part-1 Jun 02, 2026
- Chapter 844 844: Do not unlock it before Part 1 and 2 !! [Ch Jun 02, 2026
- Chapter 843 843: Check: Who is this Joker? Part-2 Jun 02, 2026
- Chapter 842 842: Check: Who is this Joker? Part-1 Jun 02, 2026
- Chapter 841 841: Check: The Ex-Sovereign: Part-2 Jun 02, 2026
- Chapter 840: Check: The Ex-Sovereign: Part-1 Jun 02, 2026
- Chapter 839: Check: Awakening The Sovereign Jun 02, 2026
- Chapter 838: Check: Freezing the Master for Eternity! Jun 02, 2026
- Chapter 837: Check: Ending the Past: Part-4 Jun 02, 2026
- Chapter 836 836: Check: Ending the Past: Part-3 Jun 02, 2026
- Chapter 835 835: Check: Ending the Past: Part-2 Jun 02, 2026
- Chapter 834: Check: Ending the Past: Part-1 Jun 02, 2026
- Chapter 833: Check: Your death belongs to me Jun 02, 2026
- Chapter 832: Check: 4 VS 2 Jun 02, 2026
- Chapter 831: Check: Another Queen Jun 02, 2026
- Chapter 830 830: You’ve served your purpose well… Sovereign Jun 02, 2026
- Chapter 829: F##ing shit... am I into women? Jun 02, 2026
- Chapter 828: Power of Sovereign: Part-2 Jun 02, 2026
- Chapter 827: Power of Sovereign: Part-1 Jun 02, 2026
- Chapter 826: Let the chaos begin Jun 02, 2026
- Chapter 825: So romantic, Victor? Jun 02, 2026
- Chapter 824: Where is Victor? Jun 02, 2026
- Chapter 823 823: Welcome to your death~ Jun 02, 2026
- Chapter 822 822: Come to The Void’s Cradle Jun 02, 2026
- Chapter 821: Victor as bait Jun 02, 2026
- Chapter 820: Alaric Betrayed Master? Jun 02, 2026
- Chapter 819: The Origin Jun 02, 2026
- Chapter 818: Alaric is a mole? Jun 02, 2026
- Chapter 817: False Alarm! Guys... It’s just FALSE!! Jun 02, 2026
- Chapter 816: Did I just hook up #### with my husband!? Jun 02, 2026
- Chapter 815: HOW DARE YOU BETRAY ME?! Jun 02, 2026
- Chapter 814: Already in your hands... Look closer Jun 02, 2026
- Chapter 813: The Question and The Answer Jun 02, 2026
- Chapter 812: A Date with Xara: Part-2 Jun 02, 2026
- Chapter 811: Aether Seraphine Jun 02, 2026
- Chapter 810: A Date with Xara: Part-1 Jun 02, 2026
- Chapter 809: Asking for forgiveness! Jun 02, 2026
- Chapter 808: Overzealous firecracker... Was it? Jun 02, 2026
- Chapter 807: Fate cannot be broken! Jun 02, 2026
- Chapter 806: Perfect lackeys for the Job! Jun 02, 2026
- Chapter 805: Aqualina... SAFE!! Jun 02, 2026
- Chapter 804: What’s going on? What are you looking for? Jun 02, 2026
- Chapter 803: Cut A Fate! Jun 02, 2026
- Chapter 802: Give back to the Real King! Jun 02, 2026
- Chapter 801: That boy is nothing! Jun 02, 2026
- Chapter 800: Kara....? Jun 02, 2026
- Chapter 799: Hope for the Best? Jun 02, 2026
- Chapter 798: Okay Signal... Finally!! Jun 02, 2026
- Chapter 797: A Promise to the Gods: Curse Jun 02, 2026
- Chapter 796: A Promise to the Gods: Blessing Jun 02, 2026
- Chapter 795: A Promise to the Gods: Part-5 Jun 02, 2026
- Chapter 794: A Promise to the Gods: Part-4 Jun 02, 2026
- Chapter 793: A Promise to the Gods: Part-3 Jun 02, 2026
- Chapter 792: A Promise to the Gods: Part-2 Jun 02, 2026
- Chapter 791: A Promise to the Gods: Part-1 Jun 02, 2026
- Chapter 790: An Happy Ending? Jun 02, 2026
- Chapter 789: I shall be your weapon until my last breath! Jun 02, 2026
- Chapter 788: Everything comes at a price! Jun 02, 2026
- Chapter 787: Master entering on the game! Jun 02, 2026
- Chapter 786: Kidnapping... who? Jun 02, 2026
- Chapter 785: Drakhairs... is not just a side character! Jun 02, 2026
- Chapter 784: Once he knows how I taste… Fu~Fu~ Jun 02, 2026
- Chapter 783: Finish her off! Jun 02, 2026
- Chapter 782: Kill both of the them! Jun 02, 2026
- Chapter 781: Weakest among all! Jun 02, 2026
- Chapter 780: An end to this Madness? Jun 02, 2026
- Chapter 779: Something is definitely wrong! Jun 02, 2026
- Chapter 778: ...Welcome to the Family? Jun 02, 2026
- Chapter 777: Aether's First Move! Jun 02, 2026
- Chapter 776: Aether getting into the Game! Jun 02, 2026
- Chapter 775: Xara... is really a waifu Material? Part-2 Jun 02, 2026
- Chapter 774: [Bonus(⌐■■)] Xara... is really a waifu Material Jun 02, 2026
- Chapter 773: [Bonus (づ ◕‿◕ )づ] Second Move... but Best move? Jun 02, 2026
- Chapter 772: Master's second Move! Jun 02, 2026
- Chapter 771: First Move... but Best move? Jun 02, 2026
- Chapter 770: Master's First Move! Jun 02, 2026
- Chapter 769: Announcing his love to the world: Part-4 Jun 02, 2026
- Chapter 768: Announcing his love to the world: Part-3 Jun 02, 2026
- Chapter 767: Announcing his love to the world: Part-2 Jun 02, 2026
- Chapter 766: Announcing his love to the world: Part-1 Jun 02, 2026
- Chapter 765: Check: The Three Pieces? Jun 02, 2026
- Chapter 764: Master... Something is wrong: Part-8 Jun 02, 2026
- Chapter 763: Master... Something is wrong: Part-7 Jun 02, 2026
- Chapter 762: Master... Something is wrong: Part-6 Jun 02, 2026
- Chapter 761: Master... Something is wrong: Part-5 Jun 02, 2026
- Chapter 760: Master... Something is wrong: Part-4 Jun 02, 2026
- Chapter 759: Master... Something is wrong: Part-3 Jun 02, 2026
- Chapter 758: [Bonus (╬⁽⁽ ⁰ ⁾⁾ Д ⁽⁽ ⁰ ⁾⁾) 200 GT] Master... S Jun 02, 2026
- Chapter 757: [Bonus ( ๑‾̀◡‾́)σ" 150 GT] Master... Something Jun 02, 2026
- Chapter 756: [Bonus (っ˘ڡ˘ς) 100 GT] Chosen among the Chosen Jun 02, 2026
- Chapter 755: [Bonus (⌐■■) 50 GT] The Spark! Jun 02, 2026
- Chapter 754: [Bonus ٩(◕‿◕)۶ 800 PS] A Dinner Talk: Signing t Jun 02, 2026
- Chapter 753: [Bonus (づ ◕‿◕ )づ] A Dinner Talk: Divorce! Jun 02, 2026
- Chapter 752: [Bonus (-‿◦)] A Dinner Talk: Adoption! Jun 02, 2026
- Chapter 751: [Bonus (•‿•)] Maybe he is the fault here? Jun 02, 2026
- Chapter 750: Getting slapped for first time! Jun 02, 2026
- Chapter 749: Why Not Xara Serpahine! Jun 02, 2026
- Chapter 748: Strange Trees Jun 02, 2026
- Chapter 747: He cannot face his Mother-in-law anymore!! Jun 02, 2026
- Chapter 746: Mother-in-law's Thoughts and Awkwardness: Part- Jun 02, 2026
- Chapter 745: Mother-in-law's Thoughts and Awkwardness: Part- Jun 02, 2026
- Chapter 744: ~Thalia Admits her Love?: Part-5~ Jun 02, 2026
- Chapter 743: ~Thalia Admits her Love?: Part-4~ Jun 02, 2026
- Chapter 742: Thalia Admits her Love?: Part-3~ Jun 02, 2026
- Chapter 741: Thalia Admits her Love?: Part-2~ Jun 02, 2026
- Chapter 740: Thalia Admits her Love?: Part-1~ Jun 02, 2026
- Chapter 739: They were so shameless! Jun 02, 2026
- Chapter 738: Reactivating the Origin Weapons Jun 02, 2026
- Chapter 737: Mother knows everything Jun 02, 2026
- Chapter 736: Thalia wants to Play! Part-2~ Jun 02, 2026
- Chapter 735: Thalia wants to Play! Part-1 Jun 02, 2026
- Chapter 734: [Bonus ಥ‿ಥ] A soul without a purpose! Jun 02, 2026
- Chapter 733: [Bonus ₍⁷⁽ˆ⁰ˆ⁾₎⁷] Can you see the FATE! Jun 02, 2026
- Chapter 732 [Bonus(づ ◕‿◕ )づ] Because... that was our final t Jun 02, 2026
- Chapter 731 Kind/Goodness is injurious to Health! Jun 02, 2026
- Chapter 730 The woman in picture! Jun 02, 2026
- Chapter 729 Snow Globe Jun 02, 2026
- Chapter 728 Monster Experiments! Jun 02, 2026
- Chapter 727 At times, emotions are the only language we can Jun 02, 2026
- Chapter 726 Changes Jun 02, 2026
- Chapter 725 This time... Maelona will protect! Jun 02, 2026
- Chapter 724 Raven's Jealous... is cute? Jun 02, 2026
- Chapter 723 Solving the Puzzle! Jun 02, 2026
- Chapter 722 When Pride become a threat to worlds! Jun 02, 2026
- Chapter 721 Our Only Pride Jun 02, 2026
- Chapter 720 Pride of an Empire: Part-7 Jun 02, 2026
- Chapter 719 Pride of an Empire: Part-6 Jun 02, 2026
- Chapter 718 Pride of an Empire: Part-5 Jun 02, 2026
- Chapter 717 [Bonus (/≧▽≦)/ 600 PS] Pride of an Empire: Part- Jun 02, 2026
- Chapter 716 [Bonus (~ ̄³ ̄)~] Pride of an Empire: Part-3 Jun 02, 2026
- Chapter 715 Pride of an Empire: Part-2 Jun 02, 2026
- Chapter 714 Pride of an Empire: Part-1 Jun 02, 2026
- Chapter 713 Three Children : Sinner :: Tricked : Grin Jun 02, 2026
- Chapter 712 He is telling the truth! Believe Him! Jun 02, 2026
- Chapter 711 Coming Clean: The Rumours Are true Jun 02, 2026
- Chapter 710 He came back for her! Jun 02, 2026
- Chapter 709 Third Trial Begins: Show me if you can bear it a Jun 02, 2026
- Chapter 708 A kiss that speaks louder than words Jun 02, 2026
- Chapter 707 Those misty eyes that shook his heart.... He lov Jun 02, 2026
- Chapter 706 Selene is broker! Jun 02, 2026
- Chapter 705 We are all waiting to see... The Happiness you w Jun 02, 2026
- Chapter 704 A Mom that he never had! Jun 02, 2026
- Chapter 703 Once was a Lab rat to everyone! Jun 02, 2026
- Chapter 702 Just keep watching! Jun 02, 2026
- Chapter 701 Mending the Unknown Fractures Jun 02, 2026
- Chapter 700 Endless Loop of Iterations! Jun 02, 2026
- Chapter 699 What the F is going on here?!! Jun 02, 2026
- Chapter 698 The choice he made... it was the only one he cou Jun 02, 2026
- Chapter 697 The timing... truly couldn't be worse anymore! Jun 02, 2026
- Chapter 696 Marisandra Naiadia... seduced, but at what cost? Jun 02, 2026
- Chapter 695 Come back to us, Aether! Jun 02, 2026
- Chapter 694 Your death is inevitable, Marisandra Naiadia Jun 02, 2026
- Chapter 693 This is how one should make their Checkmate with Jun 02, 2026
- Chapter 692 Check: Cornering the Master Jun 02, 2026
- Chapter 691 Check: A Promise to the Gods! Jun 02, 2026
- Chapter 690 Check: A Woman in Angry! Jun 02, 2026
- Chapter 689 Master cornered Aether: Part-4 Jun 02, 2026
- Chapter 688 Master cornered Aether: Part-3 Jun 02, 2026
- Chapter 687 Master cornered Aether: Part-2 Jun 02, 2026
- Chapter 686 Master cornered Aether: Part-1 Jun 02, 2026
- Chapter 685 The Master's Cunning Plan: Part-4 Jun 02, 2026
- Chapter 684 The Master's Cunning Plan: Part-3 Jun 02, 2026
- Chapter 683 The Master's Cunning Plan: Part-2 Jun 02, 2026
- Chapter 682 The Master's Cunning Plan: Part-1 Jun 02, 2026
- Chapter 681: Everything is Wrong! Jun 02, 2026
- Chapter 680: Something is Definitely Wrong: Part-10 Jun 02, 2026
- Chapter 679: Something is Definitely Wrong: Part-9 Jun 02, 2026
- Chapter 678: Something is Definitely Wrong: Part-8 Jun 02, 2026
- Chapter 677: Something is Definitely Wrong: Part-7 Jun 02, 2026
- Chapter 676: Something is Definitely Wrong: Part-6 Jun 02, 2026
- Chapter 675 Something is Definitely Wrong: Part-5 Jun 02, 2026
- Chapter 674 Something is Definitely Wrong: Part-4 Jun 02, 2026
- Chapter 673 [Bonus(⌐■■)] Something is Definitely Wrong: Part Jun 02, 2026
- Chapter 672 A Daughter-Complex Jun 02, 2026
- Chapter 671 Something is Definitely Wrong: Part-2 Jun 02, 2026
- Chapter 670 Something is Definitely Wrong: Part-1 Jun 02, 2026
- Chapter 669 Something is Wrong: Part-3 Jun 02, 2026
- Chapter 668 Something is Wrong: Part-2 Jun 02, 2026
- Chapter 667 Something is Wrong: Part-1 Jun 02, 2026
- Chapter 666 Nothing much... Just a single wish Jun 02, 2026
- Chapter 665 He couldn't do it! She is different from others. Jun 02, 2026
- Chapter 664 It's time for Whale! Jun 02, 2026
- Chapter 663 Secured the Bait! Jun 02, 2026
- Chapter 662 Aether, the time has come for you.....Choose wis Jun 02, 2026
- Chapter 661 Oh, you want to play games? Fine... Let's play! Jun 02, 2026
- Chapter 660 Everyone wants Aether's Ownership! Jun 02, 2026
- Chapter 659 I AM THE ARCANE KING! Jun 02, 2026
- Chapter 658 [Bonus ᒄ₍⁽ˆ⁰ˆ⁾₎ᒃ] There is no rest even after De Jun 02, 2026
- Chapter 657 [Bonus◟₍⁽⁰꒫⁰⁾₎◞] It's not GILF! She is F*ing OLD Jun 02, 2026
- Chapter 656 New Mission... Again? But Unique? Jun 02, 2026
- Chapter 655 Sweet Home A.... What? Jun 02, 2026
- Chapter 654 Finally A New Mission!!.... But Jun 02, 2026
- Chapter 653 I'm the saviour of millions, the one and only he Jun 02, 2026
- Chapter 652 Everything was missing! Jun 02, 2026
- Chapter 651 Calming the Empress Jun 02, 2026
- Chapter 650 Empress is on Honeymoon! Jun 02, 2026
- Chapter 649 Visiting Ebonhollow Village Jun 02, 2026
- Chapter 648 More than One Drop Jun 02, 2026
- Chapter 647 Let's Cook him! Jun 02, 2026
- Chapter 646 Unlocking his Level! Jun 02, 2026
- Chapter 645 Running is not cowardice! Jun 02, 2026
- Chapter 644 Fighting the Old Fellow: Here, I.AM.THE.KING!!! Jun 02, 2026
- Chapter 643 Fighting the Old Fellow: Kraken Surge Ad Evocatu Jun 02, 2026
- Chapter 642 [Bonus (#`O′)] Fighting the Old Fellow: Experien Jun 02, 2026
- Chapter 641 [Bonus (•ˋ ˊ•)] Talking to the old fellow Jun 02, 2026
- Chapter 640 [Bonus >﹏<]I'll crush that bastard like a bug! M Jun 02, 2026
- Chapter 639 [Bonus (っ °Д °;)っ]~Showing around What?~ Jun 02, 2026
- Chapter 638 [Bonus ^(* ̄(oo) ̄)^] Long time no see Jun 02, 2026
- Chapter 637 [Bonus (~ ̄▽ ̄)~]She's the one I love the most—Wel Jun 02, 2026
- Chapter 636 He Learned his Lessons! Jun 02, 2026
- Chapter 635 Sacrificial stones Jun 02, 2026
- Chapter 634 Jack Sparrow Far more dangerous than anyone!!! Jun 02, 2026
- Chapter 633 He'll be perfectly fine as long as he's locked a Jun 02, 2026
- Chapter 632 Messed up Family Tree! Jun 02, 2026
- Chapter 631 The truth of Aqualina: Part-3 Jun 02, 2026
- Chapter 630 The truth of Aqualina: Part-2 Jun 02, 2026
- Chapter 629 The truth of Aqualina: Part-1 Jun 02, 2026
- Chapter 628 ~You should fear me~ Jun 02, 2026
- Chapter 627 Soul-crushing pain!! Sandra! Jun 02, 2026
- Chapter 626 Empress feeling Jealous Jun 02, 2026
- Chapter 625 Hehe...That's Empress for you Jun 02, 2026
- Chapter 624 Returning to the Starting Point! Jun 02, 2026
- Chapter 623 His skill saved his Ass~ Jun 02, 2026
- Chapter 622 Greed of the... First One Jun 02, 2026
- Chapter 621 Forbidden Language~ Jun 02, 2026
- Chapter 620 Loving Step-Father Jun 02, 2026
- Chapter 619 You are a man... Think.. Decide. Act! Jun 02, 2026
- Chapter 618 I'm mad at all of you Jun 02, 2026
- Chapter 617 Boys are easy... Well, too easy! Jun 02, 2026
- Chapter 616 Vesperine's next Target... Kaelen! Jun 02, 2026
- Chapter 615 Aria was busy with her duty! Jun 02, 2026
- Chapter 614 Nothing wrong with Kira and her family, right? Jun 02, 2026
- Chapter 613 Afterglow of Passionate 'M' Moments Jun 02, 2026
- Chapter 612 ~The Perverted 'M' Professor is awakened~ Part-5 Jun 02, 2026
- Chapter 611 ~The Perverted Professor wants cute little baby~ Jun 02, 2026
- Chapter 610 ~The Perverted Professor want's more!~ Part-3~ Jun 02, 2026
- Chapter 609 ~The Perverted Professor~ Part-2~ Jun 02, 2026
- Chapter 608 ~The Perverted Professor~ Part-1~ Jun 02, 2026
- Chapter 607 ~Hiding? That's New~ Jun 02, 2026
- Chapter 606 Who would have thought... Death comes in this wa Jun 02, 2026
- Chapter 605 Two Green Hat? Why? Jun 02, 2026
- Chapter 604 It'd be cool if not for that mess on your pants Jun 02, 2026
- Chapter 603 Hehehehe... Come on, Baby Jun 02, 2026
- Chapter 602 That monster... that mansion... that man... Who Jun 02, 2026
- Chapter 601 A mother who abandoned her child in the dead of Jun 02, 2026
- Chapter 600: Wicked than human!! Jun 02, 2026
- Chapter 599: Wicked Monster! Jun 02, 2026
- Chapter 598: Is this... some kind of prank? Jun 02, 2026
- Chapter 597: Just like him? What in the world is that? Jun 02, 2026
- Chapter 596: Instead of Big Bad Wolf.... It was something el Jun 02, 2026
- Chapter 595: Instead of cute puppy, The Big Bad Wolf Jun 02, 2026
- Chapter 594: Instead of Mother, It was a cute puppy! Jun 02, 2026
- Chapter 593: Searching for Mother Part-4 Jun 02, 2026
- Chapter 592: Searching for Mother Part-3 Jun 02, 2026
- Chapter 591: Searching for Mother Part-2 Jun 02, 2026
- Chapter 590: [Bonus (●ˇ∀ˇ●) 650 PS] Searching for Mother Par Jun 02, 2026
- Chapter 589: [Bonus (●’◡’●) 600 PS] Innocent Saintess More D Jun 02, 2026
- Chapter 588: [Bonus ^^ 500 PS] Register Each other! Jun 02, 2026
- Chapter 587: Hold your horses, darling~ Jun 02, 2026
- Chapter 586: Bringing Boyfriend to room and... banging is no Jun 02, 2026
- Chapter 585: Innocent Saintess Getting Caught! Jun 02, 2026
- Chapter 584: Finnian Acting... Weird! Jun 02, 2026
- Chapter 583: A Succubus is just another Natural Creature Jun 02, 2026
- Chapter 582 A Succubus is not S* Part-4 Jun 02, 2026
- Chapter 581 A Succubus is not S* Part-3 Jun 02, 2026
- Chapter 580 A Succubus is not S* Part-2 Jun 02, 2026
- Chapter 579 A Succubus is not S* Part-1 Jun 02, 2026
- Chapter 578 A regular day in a Student's life! Jun 02, 2026
- Chapter 577 Victor! I'll buy you chocolate! Pretty please!!! Jun 02, 2026
- Chapter 576 Principal's heart shaking! Jun 02, 2026
- Chapter 575 Treat your master like a cushion? Jun 02, 2026
- Chapter 574: Neither Dragon… nor Phoenix.... It’s Draconyx Jun 02, 2026
- Chapter 573: [Bonus =^● ⋏ ●^= 650 PS] Falling for that playb Jun 02, 2026
- Chapter 572: [Bonus (◐ω◑ )600 PS] We’re going to build... a Jun 02, 2026
- Chapter 571: [Bonus ٩꒰ʘʚʘ๑꒱۶ 500 PS] Why am I being treated Jun 02, 2026
- Chapter 570: There was always a consequence! Jun 02, 2026
- Chapter 569: ~They are not stopping~ Jun 02, 2026
- Chapter 568: ~Too Hard to Leave~ Jun 02, 2026
- Chapter 567: ~A Dragon from a Dragon~ Jun 02, 2026
- Chapter 566: Maybe not!! Jun 02, 2026
- Chapter 565: Missed his Target? Jun 02, 2026
- Chapter 564: For a fierce lady... your lips... they’re reall Jun 02, 2026
- Chapter 563: May you rest in peace, shameless phoenix! Jun 02, 2026
- Chapter 562: Ebon Pillar of Eternal Rite Jun 02, 2026
- Chapter 561 Really friends? Jun 02, 2026
- Chapter 560 Pas(sed)t : Arkanis Dragonheart (A Feared Man)- Jun 02, 2026
- Chapter 559 Pas(sed)t : Arkanis Dragonheart (A Feared boy)- Jun 02, 2026
- Chapter 558: Mark this day!... VENGEANCE BEGINS! Jun 02, 2026
- Chapter 557: Seducing Woman is more important than becoming Jun 02, 2026
- Chapter 556 [Bonus ヾ(≧▽≦*)o 500 PS] For a girl who brought t Jun 02, 2026
- Chapter 555: He would have been heartbroken Jun 02, 2026
- Chapter 554 Level… 70! Jun 02, 2026
- Chapter 553 Side Story to Main Story - End of Second Trial: Jun 02, 2026
- Chapter 552 Side Story - End of Second Trial: Part-5 Jun 02, 2026
- Chapter 551 Side Story - End of Second Trial: Part-4 Jun 02, 2026
- Chapter 550 Side Story - End of Second Trial: Part-3 Jun 02, 2026
- Chapter 549 Side Story - End of Second Trial: Part-2 Jun 02, 2026
- Chapter 548 Side Story - End of Second Trial: Part-1 Jun 02, 2026
- Chapter 547 SIR!.... Yes Sir!... No Sir! Jun 02, 2026
- Chapter 546 Usurping the throne Part-4 Jun 02, 2026
- Chapter 545 Usurping the throne Part-3 Jun 02, 2026
- Chapter 544 Usurping the throne Part-2 Jun 02, 2026
- Chapter 543 Usurping the throne Part-1 Jun 02, 2026
- Chapter 542 Before Usurping the throne Part-6 Jun 02, 2026
- Chapter 541 I AM IN LOVE WITH YOU! Jun 02, 2026
- Chapter 540 Before Usurping the throne Part-5 Jun 02, 2026
- Chapter 539 Before Usurping the throne Part-4 Jun 02, 2026
- Chapter 538 Before Usurping the throne Part-3 Jun 02, 2026
- Chapter 537 Before Usurping the throne Part-2 Jun 02, 2026
- Chapter 536 Before Usurping the throne Part-1 Jun 02, 2026
- Chapter 535 I don't go for weak men Jun 02, 2026
- Chapter 534 What a load of bullshit! Jun 02, 2026
- Chapter 533 With great power comes great responsibility, Tha Jun 02, 2026
- Chapter 532 Alright, ladies. Come at me! Jun 02, 2026
- Chapter 531 Probability of Death: 90% Jun 02, 2026
- Chapter 530 I'm different than before.... far stronger than Jun 02, 2026
- Chapter 529 Vesperine is sister, right? or... Who is she? Jun 02, 2026
- Chapter 528: With you, every second feels like a new beginni Jun 02, 2026
- Chapter 527: You look absolutely stunning.... Sister Jun 02, 2026
- Chapter 526: Oh, this should be entertaining! Jun 02, 2026
- Chapter 525: Origin Pillars linked to this? Jun 02, 2026
- Chapter 524: Warning: Intruder!! Jun 02, 2026
- Chapter 523: That is my order, Selene! Jun 02, 2026
- Chapter 522: Reward: Skill: Teleportation Jun 02, 2026
- Chapter 521: FEAR will never leave me alone! Jun 02, 2026
- Chapter 520: Whoever created that thing, they must have buil Jun 02, 2026
- Chapter 519: The same as me? Jun 02, 2026
- Chapter 518: You’re not done yet, Idiot! Jun 02, 2026
- Chapter 517: Nothing… just an Elephant! Jun 02, 2026
- Chapter 516: Happy Diwali, Folks~ Jun 02, 2026
- Chapter 515 Only 1% of the Crimson Elixir of the Null remain Jun 02, 2026
- Chapter 514 This is my journey... My F Jun 02, 2026
- Chapter 513: Suck it up, B####~ Jun 02, 2026
- Chapter 512 One line... Only one Jun 02, 2026
- Chapter 511 Good people die, and bad people live on Jun 02, 2026
- Chapter 510 Did you piss yourself, Mr. Whatever-You-Are? Jun 02, 2026
- Chapter 509 Begin the festival! Jun 02, 2026
- Chapter 508 What the hell is going on?! Jun 02, 2026
- Chapter 507 ~Blue~Balled~ Jun 02, 2026
- Chapter 506 It was too humiliating! and Horrifying!!~ Jun 02, 2026
- Chapter 505 Looks like tonight I'll definitely be Jun 02, 2026
- Chapter 504 Relationship is all about give and take! Jun 02, 2026
- Chapter 503 Otherwise, we'll end up broke! Jun 02, 2026
- Chapter 502 How about we find something more... suitable to Jun 02, 2026
- Chapter 501 It's... it's blood Jun 02, 2026
- Chapter 500 WHAT THE F—! Jun 02, 2026
- Chapter 499 Good deal. I'll see you later, buddy~ Jun 02, 2026
- Chapter 498 : Access to the System of The Origin - DENIED Jun 02, 2026
- Chapter 497 : So my underwear is the backup plan, huh? Jun 02, 2026
- Chapter 496 : You never truly know what people are like unti Jun 02, 2026
- Chapter 495: Visiting Pyra Fulgur Empire... Again? Jun 02, 2026
- Chapter 494: This is my domain, you low-born creature Jun 02, 2026
- Chapter 493: Today’s been full of surprises..? Jun 02, 2026
- Chapter 492: It’s because she drank my blood? Sister, right? Jun 02, 2026
- Chapter 491: The Crimson Elixir of the Null Jun 02, 2026
- Chapter 490: Mommy is dangerous and... Weird! Jun 02, 2026
- Chapter 489: Seriously... give me a break! Jun 02, 2026
- Chapter 488: It was bloody and brutal! Jun 02, 2026
- Chapter 487: Someone is pissed off Jun 02, 2026
- Chapter 486: Becoming a Hunter Part-2 Jun 02, 2026
- Chapter 485 Becoming a Hunter Part-1 Jun 02, 2026
- Chapter 484 Welcome to the Arcane Hunters Jun 02, 2026
- Chapter 483 Commemoration Part-3 Jun 02, 2026
- Chapter 482 Commemoration Part-2 Jun 02, 2026
- Chapter 481 Commemoration Jun 02, 2026
- Chapter 480 Raven Noir Jun 02, 2026
- Chapter 479 Pyra Noirix Jun 02, 2026
- Chapter 478 Pyra Raven Jun 02, 2026
- Chapter 477 You're the shameless Phoenix! Jun 02, 2026
- Chapter 476 Took him long enough Jun 02, 2026
- Chapter 475 Was she cute now? Jun 02, 2026
- Chapter 474 Stella is shy and cute...? Jun 02, 2026
- Chapter 473 Meeting Stella After... a Long Time? Didn't End Jun 02, 2026
- Chapter 472 Filthy Rich Part-3 Jun 02, 2026
- Chapter 471 Filthy Rich! Part-2 Jun 02, 2026
- Chapter 470 Filthy Rich! Part-1 Jun 02, 2026
- Chapter 469 Looks like I've become a heartless monst— Jun 02, 2026
- Chapter 468 Mother controlling her daughter! Jun 02, 2026
- Chapter 467 ~Relaxing too much~ Jun 02, 2026
- Chapter 466 [Bonus ᕙ(⇀‸↼‶)ᕗ: 650 PS] Relaxing Jun 02, 2026
- Chapter 465 [Bonus◝(๑꒪່౪̮꒪່๑)◜: 600 PS] ~He will pay for thi Jun 02, 2026
- Chapter 464 ~Is it... too dirty?~ Jun 02, 2026
- Chapter 463 Let's see who is going to beg! Jun 02, 2026
- Chapter 462 Surprise Date Yet to be finished! Jun 02, 2026
- Chapter 461 [Bonus (◐ω◑ ): 550 PS] Surprise Date! Jun 02, 2026
- Chapter 460 Escaped? Jun 02, 2026
- Chapter 459 Kidnapped? Jun 02, 2026
- Chapter 458 Both succeed and fail at the same time? Jun 02, 2026
- Chapter 457 [Bonus (づ ◕‿◕ )づ: 500 PS] You are not Human Jun 02, 2026
- Chapter 456 Empress Scarlet Jun 02, 2026
- Chapter 455 Cursed Artifacts Jun 02, 2026
- Chapter 454 !~Ding~! Jun 02, 2026
- Chapter 453 Rowdy women? Jun 02, 2026
- Chapter 452 It's a small exchange Jun 02, 2026
- Chapter 451 It had been exactly two weeks Jun 02, 2026
- Chapter 450 Matured? Maybe not Jun 02, 2026
- Chapter 449 Aria knows! Jun 02, 2026
- Chapter 448 Replaced Souls! Jun 02, 2026
- Chapter 447 Way too Different!! Even someone changed!! Jun 02, 2026
- Chapter 446 Everything was different! Jun 02, 2026
- Chapter 445 Did you scream like a coward? Jun 02, 2026
- Chapter 444 Seeing a... Man! Jun 02, 2026
- Chapter 443 Something changed Jun 02, 2026
- Chapter 442 Log advises you to avoid dangerous activities, i Jun 02, 2026
- Chapter 441 ~Sweet Nightmare Part~2~ Jun 02, 2026
- Chapter 440 ~Sweet Nightmare~ Jun 02, 2026
- Chapter 439 My life… I will... That's my choice Jun 02, 2026
- Chapter 438 You can... slap it!! Jun 02, 2026
- Chapter 437 You're weak... Too Weak!! Jun 02, 2026
- Chapter 436 I... I can feel it now! Jun 02, 2026
- Chapter 435 [Bonus (-‿◦): 500 PS] Unknown Entity Jun 02, 2026
- Chapter 434 Eternal Slave Contract Part-2 Jun 02, 2026
- Chapter 433 Eternal Slave Contract Part-1 Jun 02, 2026
- Chapter 432 ... A Little good Past? Jun 02, 2026
- Chapter 431 A Messed up Past But... Part-1 Jun 02, 2026
- Chapter 430 A Messed up Past Part-2 Jun 02, 2026
- Chapter 429 A Messed up Past Part-1 Jun 02, 2026
- Chapter 428 An significant Past Part-2 Jun 02, 2026
- Chapter 427 An significant Past Part-1 Jun 02, 2026
- Chapter 426 An Insignificant Past with 'Little' Meaning Part Jun 02, 2026
- Chapter 425 An Insignificant Past with 'Little' Meaning Part Jun 02, 2026
- Chapter 424 An Insignificant Past with NO Meaning Jun 02, 2026
- Chapter 423 Am I... a ghost? Jun 02, 2026
- Chapter 422 Sometimes... Maybe.... Death is the correct answ Jun 02, 2026
- Chapter 421 F###!! I NEED TO RUN!! Jun 02, 2026
- Chapter 420 Why? Jun 02, 2026
- Chapter 419 Mission Failed Jun 02, 2026
- Chapter 417] Exactly what is the Principal fighting against? Jun 02, 2026
- Chapter 418] No... it can't be...ORIGIN EMPEROR! Jun 02, 2026
- Chapter 416 Another Dragon? Jun 02, 2026
- Chapter 415 Kyra is still missing Jun 02, 2026
- Chapter 414 I didn't mean to... I swear Jun 02, 2026
- Chapter 413 [Bonus (づ ◕‿◕ )づ 500 PS] I suppose people like y Jun 02, 2026
- Chapter 412 No one is above the law Jun 02, 2026
- Chapter 411 Heheh... I will Jun 02, 2026
- Chapter 410 DID YOU R* HER, YOU BASTARD?! Jun 02, 2026
- Chapter 409 Everything led to only one thing Jun 02, 2026
- Chapter 408 The entire eye was black! Jun 02, 2026
- Chapter 407 Repaying what he did Jun 02, 2026
- Chapter 406 You completed the game... but you did not win! Jun 02, 2026
- Chapter 405 Hell has broken loose Jun 02, 2026
- Chapter 404 Let's see how well you handle the future Jun 02, 2026
- Chapter 403 I am Loyal! Jun 02, 2026
- Chapter 402 Raven... What? Jun 02, 2026
- Chapter 401 Is... is she cute, or is she evolving into somet Jun 02, 2026
- Chapter 400 Shattered Heart! Jun 02, 2026
- Chapter 399 Weird woman Jun 02, 2026
- Chapter 398 Penelope Jun 02, 2026
- Chapter 397 Changing the Past? Jun 02, 2026
- Chapter 396 Happy times live short... Sad times live short.. Jun 02, 2026
- Chapter 395 Ewww... Why are you always laughing? That's cree Jun 02, 2026
- Chapter 394 Don't fear the test—Fear what Jun 02, 2026
- Chapter 393 Welcome to the Peace, Gentleman~! Jun 02, 2026
- Chapter 392 Taking the Horn! Jun 02, 2026
- Chapter 391 Got Cursed Jun 02, 2026
- Chapter 390 Origin Emperor? Jun 02, 2026
- Chapter 389 Steal the horns from the Ex-Arcane King? Jun 02, 2026
- Chapter 388 Welcome to the Peace, Ladies~! Jun 02, 2026
- Chapter 387 Growing Older Jun 02, 2026
- Chapter 386 The One and Only Heart Game Jun 02, 2026
- Chapter 385 Inferno-Pyremourn Summit Jun 02, 2026
- Chapter 384 A place forged by the deaths of Jun 02, 2026
- Chapter 383 Dragon Emperor will kill you for it!! Jun 02, 2026
- Chapter 382 Nothing about.... Raven Noir Jun 02, 2026
- Chapter 381 A wonderful Date? Jun 02, 2026
- Chapter 380 [Bonus 500PT (っ˘ڡ˘ς)] I'll deal with him later Jun 02, 2026
- Chapter 379 [Bonus 50GT(。><)ノ] Tell me what you seek! Jun 02, 2026
- Chapter 378 [Bonus 50GT (~ ̄³ ̄)~] Pyra Fulgur Empire Jun 02, 2026
- Chapter 377 Another Yandere?...... Please no more!! Jun 02, 2026
- Chapter 376 Soul Strength? Jun 02, 2026
- Chapter 375 A True Masterpiece!! Jun 02, 2026
- Chapter 374 ~Every H##E is a G##L~ Jun 02, 2026
- Chapter 373 ~She lost again... but loved it~ Jun 02, 2026
- Chapter 372 ~Third Round "~AHHhhh~"~ Jun 02, 2026
- Chapter 371 She lost yet.... She won! Jun 02, 2026
- Chapter 370 Second Round Is she serious? Ah... Fu##!! Jun 02, 2026
- Chapter 369 Liora Darkfang... A Born Warrior! Jun 02, 2026
- Chapter 368 'Father' and 'Dad' are not same!! Jun 02, 2026
- Chapter 367 Rich!!!!!!! Jun 02, 2026
- Chapter 366 Liora's Puppy Eyes Jun 02, 2026
- Chapter 365 Quite a hefty amount Jun 02, 2026
- Chapter 364 Black Market! Jun 02, 2026
- Chapter 363 [Bonus ( ๑‾̀◡‾́)σ"] Lackey!! Jun 02, 2026
- Chapter 362 New Unknown Skill! Jun 02, 2026
- Chapter 361: Torturing? He is not good at it! Jun 02, 2026
- Chapter 360: Mommy's Girl! Jun 02, 2026
- Chapter 359: Reject it.... Dear Jun 02, 2026
- Chapter 358: Helena's Death? Jun 02, 2026
- Chapter 357: Lets end this parade! Jun 02, 2026
- Chapter 356: Principal Arrived... So What? Jun 02, 2026
- Chapter 355: F* Him? What? Jun 02, 2026
- Chapter 354: The Beginning.... Shall Begin! Jun 02, 2026
- Chapter 353: Saving a damsel in distress? Nope!!! Jun 02, 2026
- Chapter 352: Out, Out, Out, Everyone out!!! Jun 02, 2026
- Chapter 351: Finally Escaping from Death!! Jun 02, 2026
- Chapter 350: Academy is in Danger Part-14 Jun 02, 2026
- Chapter 349: Side Story to Main Events! Jun 02, 2026
- Chapter 348: [Bonus (--) zzZ] Side Story: Love Letters and B Jun 02, 2026
- Chapter 347: [Bonus (ง'̀-'́)ง] Aether realized how to get th Jun 02, 2026
- Chapter 346: [Bonus٩(◕‿◕)۶]Academy is in Danger Part-13 Jun 02, 2026
- Chapter 345: Academy is in Danger Part-12 Jun 02, 2026
- Chapter 344: Academy is in Danger Part-11 Jun 02, 2026
- Chapter 343: Academy is in Danger Part-10 Jun 02, 2026
- Chapter 342: Academy is in Danger Part-9 Jun 02, 2026
- Chapter 341: Something wrong with Helena? Jun 02, 2026
- Chapter 340: Helena Sunfire Jun 02, 2026
- Chapter 339: Academy is in Danger Part-8 Jun 02, 2026
- Chapter 338: Academy is in Danger Part-7 Jun 02, 2026
- Chapter 337: Academy is in Danger Part-6 Jun 02, 2026
- Chapter 336: Academy is in Danger Part-5 Jun 02, 2026
- Chapter 335: Academy is in Danger Part-4 Jun 02, 2026
- Chapter 334: Academy is in Danger Part-3 Jun 02, 2026
- Chapter 333: Academy is in Danger Part-2 Jun 02, 2026
- Chapter 332: Academy is in Danger Part-1 Jun 02, 2026
- Chapter 331: Everyone go... PUFFF! Jun 02, 2026
- Chapter 330: A grown woman getting spoiled! Jun 02, 2026
- Chapter 329: She is not a Pervert!!! Jun 02, 2026
- Chapter 328: Flipped her switch! Jun 02, 2026
- Chapter 327: Riding something? Jun 02, 2026
- Chapter 326: He killed everyone! A True Monster! Jun 02, 2026
- Chapter 325: A Date with Delphine Jun 02, 2026
- Chapter 324: Asking out?!! Jun 02, 2026
- Chapter 323: An Artifact? Jun 02, 2026
- Chapter 322: Tsundere now... Dere~Dere! Jun 02, 2026
- Chapter 321: Devil's Devilette and Angle Part-4 Jun 02, 2026
- Chapter 320: Her shyness really cute Jun 02, 2026
- Chapter 319: Lycorian Language Jun 02, 2026
- Chapter 318: You Monster!! Jun 02, 2026
- Chapter 317: Selene helping Aether to get a girl?!! Jun 02, 2026
- Chapter 316: Know your place, Servant! Jun 02, 2026
- Chapter 315: Done Molesting! Jun 02, 2026
- Chapter 314: Horror Movie? Jun 02, 2026
- Chapter 313: ~Not so sensitive on the backdoor~ Jun 02, 2026
- Chapter 312: ~Harder, Daddy~ Jun 02, 2026
- Chapter 311: ~Spanking~ Jun 02, 2026
- Chapter 310: Someone is enjoying Jun 02, 2026
- Chapter 309: Devil and Angel Part-3 Jun 02, 2026
- Chapter 308: Devil and Angel Part-2 Jun 02, 2026
- Chapter 307: No one could escape from his grasp! Jun 02, 2026
- Chapter 306: Devil and Angel Part-1 Jun 02, 2026
- Chapter 305: Almost got caught!! Jun 02, 2026
- Chapter 304: Selene Failed Yet again! Jun 02, 2026
- Chapter 303: Getting even Creepier Jun 02, 2026
- Chapter 302: He is moving on with his plan Jun 02, 2026
- Chapter 301: It’s getting messy Jun 02, 2026
- Chapter 300: He is my Friend! Jun 02, 2026
- Chapter 299: A man could have as many as he loves!! Jun 02, 2026
- Chapter 298: Death Spells Jun 02, 2026
- Chapter 297: Someone's framing me! Jun 02, 2026
- Chapter 296: Alaric's sudden visit Jun 02, 2026
- Chapter 295: He is definitely not innocent! Jun 02, 2026
- Chapter 294: Lights, Camera and.... Action! Jun 02, 2026
- Chapter 293: Eunuch or a brain-dead MC Jun 02, 2026
- Chapter 292: Aqualina... NTRed! Jun 02, 2026
- Chapter 291: New Powers? Jun 02, 2026
- Chapter 290: Succubus's Pheromones Jun 02, 2026
- Chapter 289: A Flower and A Human Jun 02, 2026
- Chapter 288: Principal was Molested? Jun 02, 2026
- Chapter 287: Bonus Chapter ᕙ(⇀‸↼‶)ᕗ (500 PS) Jun 02, 2026
- Chapter 286: Bonus Chapter ٩꒰ʘʚʘ๑꒱۶ (500 PS) Jun 02, 2026
- Chapter 285: Bonus Chapter ٩(◕‿◕)۶(50 GT) Jun 02, 2026
- Chapter 284: Single glance! Jun 02, 2026
- Chapter 283: No Face-Slapping! Jun 02, 2026
- Chapter 282: First timer Jun 02, 2026
- Chapter 281: Innocent Aether.... Dead!! Jun 02, 2026
- Chapter 280: Lia really surprised him.... But she also shock Jun 02, 2026
- Chapter 279: Good Family? Jun 02, 2026
- Chapter 278: Molester! Jun 02, 2026
- Chapter 277: Devil Jun 02, 2026
- Chapter 276: Should I walk in naked to impress him? Jun 02, 2026
- Chapter 275: Yanderes becoming friends Jun 02, 2026
- Chapter 274 : Second Trial.... Begins! Jun 02, 2026
- Chapter 273 : Mother's Embrace Jun 02, 2026
- Chapter 272: Hello, Mother! Jun 02, 2026
- Chapter 271: Returning to SSA Jun 02, 2026
- Chapter 270: His Thing is... little weird! Jun 02, 2026
- Chapter 269: ~Bonus Chapter (~ ̄³ ̄)~ Jun 02, 2026
- Chapter 268 : Liora's shyness! Jun 02, 2026
- Chapter 267 : We will take care of everything! Jun 02, 2026
- Chapter 266: Alaric Fucked up! Jun 02, 2026
- Chapter 265: Death is still scary! Jun 02, 2026
- Chapter 264: Make me fall for you! Jun 02, 2026
- Chapter 263: Nightmares...? Jun 02, 2026
- Chapter 262: Your Hands! Jun 02, 2026
- Chapter 261: Background Characters Must Die for the Characte Jun 02, 2026
- Chapter 260: Yo! Motherfucker! Jun 02, 2026
- Chapter 259: I love you, Dear Jun 02, 2026
- Chapter 258: He doesn't have much time Jun 02, 2026
- Chapter 257: End of the world! Jun 02, 2026
- Chapter 256: Who is he? Jun 02, 2026
- Chapter 255: Steal it!! Jun 02, 2026
- Chapter 254: SAA Part-2 Jun 02, 2026
- Chapter 253: SAA Part-1 Jun 02, 2026
- Chapter 252: Liora's relentless pursuit! Jun 02, 2026
- Chapter 251: A lonely love Jun 02, 2026
- Chapter 250: If I can't have you, then no one will Jun 02, 2026
- Chapter 249: I know you said I shouldn't do this, but Jun 02, 2026
- Chapter 248: Not that he Expected! Jun 02, 2026
- Chapter 247: Mother-in-law... Too much!! Jun 02, 2026
- Chapter 246: Before the Duel! Jun 02, 2026
- Chapter 245: Ancient Language? Jun 02, 2026
- Chapter 244: I am not human, am I? Jun 02, 2026
- Chapter 243: Aria~ You are making me go crazy~ Jun 02, 2026
- Chapter 242: ~Yess~suckk~meee~ Jun 02, 2026
- Chapter 241: Aether planing something! Jun 02, 2026
- Chapter 240: Emperor planing something again! Jun 02, 2026
- Chapter 239: My love! Jun 02, 2026
- Chapter 238: Liora Darkfang Jun 02, 2026
- Chapter 237: Too many women!!! Jun 02, 2026
- Chapter 236: What in the world is this? Jun 02, 2026
- Chapter 235: Let's play a game Jun 02, 2026
- Chapter 234: I still love her! Jun 02, 2026
- Chapter 233: Maelona Zephyr Jun 02, 2026
- Chapter 232: Modified Log Jun 02, 2026
- Chapter 231: Hope Aether is alive Jun 02, 2026
- Chapter 230: Eternal Seal Jun 02, 2026
- Chapter 229: ~Selene Frostblade: A Sane girl!~ Jun 02, 2026
- Chapter 228: ~Selene Frostblade: A hidden Mission!~ Jun 02, 2026
- Chapter 227: ~Aether~ Jun 02, 2026
- Chapter 226: She is turning dangerous! Jun 02, 2026
- Chapter 225: Locked by a Yandere!! Jun 02, 2026
- Chapter 224: Aether's mind again short-circuited! Jun 02, 2026
- Chapter 223: Finished Quick? Jun 02, 2026
- Chapter 222: Selene's Doubtful gaze! Jun 02, 2026
- Chapter 221: Why do I feel like I'm raising something danger Jun 02, 2026
- Chapter 220: Is she a child? Jun 02, 2026
- Chapter 219: I forgot to tell you something important.... He Jun 02, 2026
- Chapter 218: Aria makes her move! Jun 02, 2026
- Chapter 217: Disgusting Brothel Jun 02, 2026
- Chapter 216: I will bite you off!! Jun 02, 2026
- Chapter 215: ~I am just returning the favour~ Jun 02, 2026
- Chapter 214: All for Aether! Jun 02, 2026
- Chapter 213: Celestia Nocturne... A Heartless Creature Jun 02, 2026
- Chapter 212: Victor is hated by Aether's loved ones! Jun 02, 2026
- Chapter 211: I WILL MAKE YOU MINE SANDRA! Jun 02, 2026
- Chapter 210: Empress is Making her Move! Jun 02, 2026
- Chapter 209: A abnormal Monster appeared! Jun 02, 2026
- Chapter 208: Name is Jun 02, 2026
- Chapter 207: Heheh.... A Villain! Jun 02, 2026
- Chapter 206: End of the Contest.... Mysterious figure! Jun 02, 2026
- Chapter 205: Capture the flag: A quite Satisfaction Jun 02, 2026
- Chapter 204: Capture the flag: Bromance Jun 02, 2026
- Chapter 203: Capture the Heart: Part-15 Jun 02, 2026
- Chapter 202: Capture the Heart: Part-14 Jun 02, 2026
- Chapter 201: Capture the Heart: Part-13 Jun 02, 2026
- Chapter 200: Capture the Heart: Part-12 Jun 02, 2026
- Chapter 199: Capture the Heart: Part-11 Jun 02, 2026
- Chapter 198: Capture the Heart: Part-10 Jun 02, 2026
- Chapter 197: Capture the Heart: Part-9 Jun 02, 2026
- Chapter 196: Capture the Heart: Part-8 Jun 02, 2026
- Chapter 195: Capture the Heart: Part-7 Jun 02, 2026
- Chapter 194: Capture the Heart: Part-6 Jun 02, 2026
- Chapter 193: Capture the Flag: Part-6 Jun 02, 2026
- Chapter 192: Capture the Flag: Part-5 Jun 02, 2026
- Chapter 191: She is freaking cute!!! Jun 02, 2026
- Chapter 190: Aria Zephyr's Heart Captured! Jun 02, 2026
- Chapter 189: Capture the Heart: Part-5 Jun 02, 2026
- Chapter 188: Capture the Heart: Part-4 Jun 02, 2026
- Chapter 187: Capture the Heart: Part-3 Jun 02, 2026
- Chapter 186: Capture the Heart: Part-2 Jun 02, 2026
- Chapter 185: Capture the Heart: Part-1 Jun 02, 2026
- Chapter 184: Capture the Flag: Part-4 Jun 02, 2026
- Chapter 183: Capture the Flag: Part-3 Jun 02, 2026
- Chapter 182: Capture the Flag: Part-2 Jun 02, 2026
- Chapter 181: Capture the Flag: Part-1 Jun 02, 2026
- Chapter 180: Beginning of the Contest Jun 02, 2026
- Chapter 179: Preparing for the Contest Part-2 Jun 02, 2026
- Chapter 178: Preparing for the Contest Part-1 Jun 02, 2026
- Chapter 177: Coward! Jun 02, 2026
- Chapter 176: Snaped Jun 02, 2026
- Chapter 175: As long as you kill Her Jun 02, 2026
- Chapter 174: Worst Gifts? Jun 02, 2026
- Chapter 173: I don’t like a... 'Big brother' Jun 02, 2026
- Chapter 172: Cutting Ties Part-3 Jun 02, 2026
- Chapter 171: Cutting Ties Part-2 Jun 02, 2026
- Chapter 170: Cutting Ties Part-1 Jun 02, 2026
- Chapter 169: Marriage already? Jun 02, 2026
- Chapter 168: Maid is a just a tool! Jun 02, 2026
- Chapter 167: Love or Lust? Jun 02, 2026
- Chapter 166: Kissing the Forehead.... Means love! Jun 02, 2026
- Chapter 165: Some girls really innocent, You know!! Jun 02, 2026
- Chapter 164: Escape from this weird Girl Jun 02, 2026
- Chapter 163: That place!! Jun 02, 2026
- Chapter 162: This is better than K-Dramas Jun 02, 2026
- Chapter 161: Punishment? Jun 02, 2026
- Chapter 160: Taylor is kind of sexy Part-3 Jun 02, 2026
- Chapter 159: Taylor is kind of sexy Part-2 Jun 02, 2026
- Chapter 158: Taylor is kind of sexy Part-1 Jun 02, 2026
- Chapter 157: Anonymous packages Jun 02, 2026
- Chapter 156: First Trial Begins Jun 02, 2026
- Chapter 155: Good? No, The BEST!! Jun 02, 2026
- Chapter 154: Sharing and Caring!! Jun 02, 2026
- Chapter 153: Don't underestimate the Girls Part-3 Jun 02, 2026
- Chapter 152: Don't underestimate the Girls Part-2 Jun 02, 2026
- Chapter 151: Don't underestimate the Girls Part-1 Jun 02, 2026
- Chapter 150: Money is still The Money Jun 02, 2026
- Chapter 149: Pillars of the Academy Jun 02, 2026
- Chapter 148: What a Pain! Jun 02, 2026
- Chapter 147: Date? Jun 02, 2026
- Chapter 146: Who is MC? Jun 02, 2026
- Chapter 145: Aether's heart stolen Jun 02, 2026
- Chapter 144: Become a Black Sheep Part-2 Jun 02, 2026
- Chapter 143: Become a Black Sheep Part-1 Jun 02, 2026
- Chapter 142: Blame it on Empress! Jun 02, 2026
- Chapter 141: Alaric Again! Jun 02, 2026
- Chapter 140: He is still a Servant Jun 02, 2026
- Chapter 139: Register it! Jun 02, 2026
- Chapter 138: Aqualina is a Villainess Jun 02, 2026
- Chapter 137: Aria is easy woman..? Jun 02, 2026
- Chapter 136: His Dark side again and again coming out! Jun 02, 2026
- Chapter 135: Rizz her with compliments Jun 02, 2026
- Chapter 134: Teenage Hormones Jun 02, 2026
- Chapter 133: Love is pouring out like a broken dam Jun 02, 2026
- Chapter 132: Something is wrong Jun 02, 2026
- Chapter 131: Don't die on me!! Jun 02, 2026
- Chapter 130: Sovereign Arcanum Academy Part-5 Jun 02, 2026
- Chapter 129: Sovereign Arcanum Academy Part-4 Jun 02, 2026
- Chapter 128: Sovereign Arcanum Academy Part-3 Jun 02, 2026
- Chapter 127: Sovereign Arcanum Academy Part-2 Jun 02, 2026
- Chapter 126: Selene made different Jun 02, 2026
- Chapter 125: Aether is Tsundere... Really? Jun 02, 2026
- Chapter 124: You checking out both ladies Jun 02, 2026
- Chapter 123: Sovereign Arcanum Academy Part-1 Jun 02, 2026
- Chapter 122: Before Academy Part-4 Jun 02, 2026
- Chapter 121: Before Academy Part-3 Jun 02, 2026
- Chapter 120: Before Academy Part-2 Jun 02, 2026
- Chapter 119: Before Academy Part-1 Jun 02, 2026
- Chapter 118: An art of Seduction begins Jun 02, 2026
- Chapter 117: Truth behind his Arcane Card Jun 02, 2026
- Chapter 116: I will make her mine Jun 02, 2026
- Chapter 115: Bonus Chapter... (๑ˇεˇ๑) Jun 02, 2026
- Chapter 114: Everyone was Traumatized Jun 02, 2026
- Chapter 113: That would be a problem for my future plans Jun 02, 2026
- Chapter 112: That 'Thing' Jun 02, 2026
- Chapter 111: Chains of Eternal Slave Jun 02, 2026
- Chapter 110: Restrains Part-3 Jun 02, 2026
- Chapter 109: Restrains Part-2 Jun 02, 2026
- Chapter 108: Restrains Part-1 Jun 02, 2026
- Chapter 107: Power of Nuclear Bomb...? Jun 02, 2026
- Chapter 106: Drunk man is Angry Part-4 Jun 02, 2026
- Chapter 105: Drunk man is Angry Part-3 Jun 02, 2026
- Chapter 104: Drunk man is Angry Part-2 Jun 02, 2026
- Chapter 103: Drunk Man is Angry Part-1 Jun 02, 2026
- Chapter 102: Drunken Man Part-4 Jun 02, 2026
- Chapter 101: Drunken Man Part-3 Jun 02, 2026
- Chapter 100: Drunken man Part-2 Jun 02, 2026
- Chapter 99: Drunken man Part-1 Jun 02, 2026
- Chapter 98: A successful Plan Jun 02, 2026
- Chapter 97: Only Her Jun 02, 2026
- Chapter 96: No one is looking Jun 02, 2026
- Chapter 95: Battle Arena Jun 02, 2026
- Chapter 94: Saved himself Jun 02, 2026
- Chapter 93: He was getting tired for unknown reasons Jun 02, 2026
- Chapter 92: Dancing is good Jun 02, 2026
- Chapter 91: He is the Womanizer Jun 02, 2026
- Chapter 90: Fake Shadow Jun 02, 2026
- Chapter 89: Thank you for your help Jun 02, 2026
- Chapter 88: You are not suitable Jun 02, 2026
- Chapter 87: Love? Jun 02, 2026
- Chapter 86: Stars of the Show Jun 02, 2026
- Chapter 85: Where have you been? Jun 02, 2026
- Chapter 84: A big shit!! Jun 02, 2026
- Chapter 83: Aether was really going to die Jun 02, 2026
- Chapter 82: The Empress really testing his patience Jun 02, 2026
- Chapter 81: Meeting The Empress again Jun 02, 2026
- Chapter 80: Arriving at the Palace Jun 02, 2026
- Chapter 79: Before the Empress Jun 02, 2026
- Chapter 78: Returned to the Starting Point Jun 02, 2026
- Chapter 77: Let's hurry now Jun 02, 2026
- Chapter 76: It hates Jun 02, 2026
- Chapter 75: What did I do deserve this!! Jun 02, 2026
- Chapter 74: It must be that Timmy Jun 02, 2026
- Chapter 73: Stella? Jun 02, 2026
- Chapter 72: A Man in thirties can understand a woman in thir Jun 02, 2026
- Chapter 71: He was beyond Horrified!! Jun 02, 2026
- Chapter 70: Anger cannot explained in a single word Jun 02, 2026
- Chapter 69: Please don't leave me Jun 02, 2026
- Chapter 68: It's Over!!! Jun 02, 2026
- Chapter 67: He had no other choice Jun 02, 2026
- Chapter 66: Hesitation almost cost a life Jun 02, 2026
- Chapter 65: She needs you Jun 02, 2026
- Chapter 64: It's coming Jun 02, 2026
- Chapter 63: I hate her Jun 02, 2026
- Chapter 62: Thrill! Jun 02, 2026
- Chapter 61: Leave her Jun 02, 2026
- Chapter 60: Save her at any cost Jun 02, 2026
- Chapter 59: Happy times lives short Jun 02, 2026
- Chapter 58: All I did.... just for you! Jun 02, 2026
- Chapter 57: I Too Jun 02, 2026
- Chapter 56: They left me Jun 02, 2026
- Chapter 55: Call me by my title Jun 02, 2026
- Chapter 54: Sliver Star Jun 02, 2026
- Chapter 53: A Man in thirties cannot understand a teenage gi Jun 02, 2026
- Chapter 52: It's getting worse Jun 02, 2026
- Chapter 51: Slave Mark are Necessary for Slaves Jun 02, 2026
- Chapter 50: Mission Updated Jun 02, 2026
- Chapter 49: Luck or not Jun 02, 2026
- Chapter 48 He was really f*ed up Jun 02, 2026
- Chapter 47 He is.... Dead Man Jun 02, 2026
- Chapter 46: Danger!!!! Jun 02, 2026
- Chapter 45: Yes, it’s really lovely Jun 02, 2026
- Chapter 44: Only two rooms Jun 02, 2026
- Chapter 43: Delphine Frostblade Jun 02, 2026
- Chapter 42: My Grandson!! Jun 02, 2026
- Chapter 41: Chocolate and Cookies Jun 02, 2026
- Chapter 40: Wasted Jun 02, 2026
- Chapter 39: Monster Hunting Jun 02, 2026
- Chapter 38: Eating is important!! Jun 02, 2026
- Chapter 37: No more like he regained his emotions Jun 02, 2026
- Chapter 36: Survival rate increases...? Jun 02, 2026
- Chapter 35: Touch your heart Jun 02, 2026
- Chapter 34: The prophecy, right? Jun 02, 2026
- Chapter 33: World’s Biggest Sinful Person Jun 02, 2026
- Chapter 32: YOU ANGERED OUR MOTHER!! Jun 02, 2026
- Chapter 31: Contract to ######## Jun 02, 2026
- Chapter 30: Okay, Now Right hand! Jun 02, 2026
- Chapter 29: Kill that Man!! Jun 02, 2026
- Chapter 28: Try using your Arcane Card Jun 02, 2026
- Chapter 27: I am truly disappointed Jun 02, 2026
- Chapter 26: New informations Jun 02, 2026
- Chapter 25: Baptism Starts! Jun 02, 2026
- Chapter 24: Empress Marisandra Naiadia Jun 02, 2026
- Chapter 23: Affection points Jun 02, 2026
- Chapter 22: A week since then Jun 02, 2026
- Chapter 21: Affection from anyone Jun 02, 2026
- Chapter 20: I know the reasons behind your actions, but Jun 02, 2026
- Chapter 19: Cockroach Jun 02, 2026
- Chapter 18: Survival rate Jun 02, 2026
- Chapter 17: An Eternal slave shall Jun 02, 2026
- Chapter 16: A.L.F.R.E.D! Jun 02, 2026
- Chapter 15: Cursed Jun 02, 2026
- Chapter 14: Ether or Aether Jun 02, 2026
- Chapter 13: Mortimer Frostblade Jun 02, 2026
- Chapter 12: Frozen world Jun 02, 2026
- Chapter 11: My name is Aether... Master Jun 02, 2026
- Chapter 10: Slave.... Eternal Contract Jun 02, 2026
- Chapter 9: !~Ding~! Jun 02, 2026
- Chapter 8: He seems to have emotions of Jun 02, 2026
- Chapter 7: Does he swing that way? Jun 02, 2026
- Chapter 6: DON’T TOUCH ME!! Jun 02, 2026
- Chapter 5: He just faced his…. Another death? Jun 02, 2026
- Chapter 4: Laugh Jun 02, 2026
- Chapter 3: Wee, Woo, Wee, Woo Jun 02, 2026
- Chapter 2: FINALLY, I GOT A JOB!!! Jun 02, 2026
- Chapter 1: Prologue Jun 02, 2026
User Comments
0 comments from readers