Summary
Lucifer,anordinaryorphanboywhowasbroughtupbyawealthyfamilytobetheplaymateoftheirdaughter.That'showthingshavebeenuntilonenight,whenhegotattackbysomethingunnatural,thatwasthenighttheworldchangedforhim.p.sThisworldisgoingtobedark,lotsofkillings,alotofr18contents,mostnoteveninvolvingtheMC,alsoMcisnotgoingtotakeallthegirlshecomesacross,hewillhavefemalefriendshewillmakealongtheway,therewillbeYuricontentsandlotsmore,butActionsprevailsthemall.
You May Also Like
Novel Chapters 294
- Chapter 294: The Core Jun 17, 2026
- Chapter 293 293: Descent Jun 17, 2026
- Chapter 292 292: The Hunters Become the Hunted Jun 17, 2026
- Chapter 291: The Collector’s Trail Jun 17, 2026
- Chapter 290: The Coast of Broken Things Jun 17, 2026
- Chapter 289: The Library of Lost Names Jun 17, 2026
- Chapter 288: The Threshold Jun 17, 2026
- Chapter 287: The Awakening and the Departure Jun 17, 2026
- Chapter 286: One Hundred Years Later Jun 17, 2026
- Chapter 285: The Long Road Home Jun 17, 2026
- Chapter 284: What Comes After Jun 17, 2026
- Chapter 283: Endgame 2: The Progenitor’s Wager Jun 17, 2026
- Chapter 282: Endgame 1 Jun 17, 2026
- Chapter 281: Climax 2 Jun 17, 2026
- Chapter 280: Climax 1 Jun 17, 2026
- Chapter 279 279: Welcome Progenitor Jun 17, 2026
- Chapter 278 278: Done Watching Jun 17, 2026
- Chapter 277 277: Evolution Jun 17, 2026
- Chapter 276 276: the True Progenitor of the Vampire Line Jun 17, 2026
- Chapter 275 275: The Revenant Jun 17, 2026
- Chapter 274 274: “That’s… not part of the script.” Jun 17, 2026
- Chapter 273 273: King Of The Crimson Night Jun 17, 2026
- Chapter 272 272: “Just… just don’t get yourselves killed.” Jun 17, 2026
- Chapter 271 271: Surprised Ally Jun 17, 2026
- Chapter 270 270: Just Business Jun 17, 2026
- Chapter 269 269: A Killing Spree Jun 17, 2026
- Chapter 268 268: “I’m what comes next.” Jun 17, 2026
- Chapter 267 267: "Perfect. Let hate carve the path." Jun 17, 2026
- Chapter 266 266: Lucifer vs. Nythra Jun 17, 2026
- Chapter 265 265: Nythra Jun 17, 2026
- Chapter 264 264: Back To Earth Jun 17, 2026
- Chapter 263 263: “We’ll bring her back. No matter what it ta Jun 17, 2026
- Chapter 262 262: The Last Words Jun 17, 2026
- Chapter 261 261: The Remains Jun 17, 2026
- Chapter 260 260: Ken And Dera Jun 17, 2026
- Chapter 259 259: Fatherly Talk Jun 17, 2026
- Chapter 258 258: “Fuck, you’re trouble,”* Jun 17, 2026
- Chapter 257 257: “Don’t do that.”* Jun 17, 2026
- Chapter 256 256: Preparations Jun 17, 2026
- Chapter 255: Your Maker Jun 17, 2026
- Chapter 254: New Dera Jun 17, 2026
- Chapter 253: The Gathering Jun 17, 2026
- Chapter 252 252: The Gathering Of The Firsts Jun 17, 2026
- Chapter 251: Cosmic Unrest Jun 17, 2026
- Chapter 250: The Adversaries Jun 17, 2026
- Chapter 249: “Fuck, Luna,”* Jun 17, 2026
- Chapter 248: “Ride me,”* Jun 17, 2026
- Chapter 247: “Your turn,”* Jun 17, 2026
- Chapter 246: Return To The V World Jun 17, 2026
- Chapter 245: "The Demon King of Gluttony." Jun 17, 2026
- Chapter 244: Remu Is Back Jun 17, 2026
- Chapter 243: “Lord Daniel awaits,”* Jun 17, 2026
- Chapter 242: “God no,” Jun 17, 2026
- Chapter 241: Family Reunion Jun 17, 2026
- Chapter 240: Waking Lilith Jun 17, 2026
- Chapter 239: Going To See Lilith Jun 17, 2026
- Chapter 238: King Of Gluttony Jun 17, 2026
- Chapter 237: The Kings Jun 17, 2026
- Chapter 236: Incubus Form Jun 17, 2026
- Chapter 235: Meeting Daniel Jun 17, 2026
- Chapter 234: Going To The Demon Realm Jun 17, 2026
- Chapter 233: Remu Jun 17, 2026
- Chapter 232: New Earth Jun 17, 2026
- Chapter 231: Brother’s Talk Jun 17, 2026
- Chapter 230: Rewards Jun 17, 2026
- Chapter 229: [Primordial Blood Drive] Jun 17, 2026
- Chapter 228: [Welcome to the 100th Floor.] Jun 17, 2026
- Chapter 227: "Now I know you’re dying." Jun 17, 2026
- Chapter 226: “Cum for me, Zane.”* Jun 17, 2026
- Chapter 225: "That’s the question, isn’t it?" Jun 17, 2026
- Chapter 224: (No one knows.) Jun 17, 2026
- Chapter 223: "That was… intense."* Jun 17, 2026
- Chapter 222: "I want you to."* Jun 17, 2026
- Chapter 221: Mythic Class Jun 17, 2026
- Chapter 220: Even Kings Bleed Jun 17, 2026
- Chapter 219: "You’re not my equal." Jun 17, 2026
- Chapter 218: Kneel Jun 17, 2026
- Chapter 217: "You’re a fucking joke." Jun 17, 2026
- Chapter 216: "No. I’m your correction." Jun 17, 2026
- Chapter 215: Vrahl’An Jun 17, 2026
- Chapter 214: "You’re in for the fight of your life." Jun 17, 2026
- Chapter 213: "The world may burn again." Jun 17, 2026
- Chapter 212: Reclamation Jun 17, 2026
- Chapter 211: A Pissed Daniel Jun 17, 2026
- Chapter 210: "…So close." Jun 17, 2026
- Chapter 209: Boss Battle 2 Jun 17, 2026
- Chapter 208: Boss Battle 1 Jun 17, 2026
- Chapter 207: Blood Domain: Abyssal Variant Jun 17, 2026
- Chapter 206: Absolute Comma Jun 17, 2026
- Chapter 205: Clearing The 10 Floors Jun 17, 2026
- Chapter 204: Fall with me Jun 17, 2026
- Chapter 203: "It’s complicated." Jun 17, 2026
- Chapter 202: The Tower Jun 17, 2026
- Chapter 201: Building The Realm Jun 17, 2026
- Chapter 200: Bloodline Of Ruin Jun 17, 2026
- Chapter 199: Addressing The People Jun 17, 2026
- Chapter 198: Valecar Hatred Jun 17, 2026
- Chapter 197: The returned King Jun 17, 2026
- Chapter 196: The Progenitor had returned Jun 17, 2026
- Chapter 195: The Lords Jun 17, 2026
- Chapter 194: The King And His Lords (read the next - before Jun 17, 2026
- Chapter 193: I’m home Jun 17, 2026
- Chapter 192: You can stay. Or leave. I don’t care Jun 17, 2026
- Chapter 191: "I’m here to claim what’s mine." Jun 17, 2026
- Chapter 190: The Throne Jun 17, 2026
- Chapter 189: "They weren’t strong enough." Jun 17, 2026
- Chapter 188: "I am." Jun 17, 2026
- Chapter 187: Move Jun 17, 2026
- Chapter 186: "So you believe me?" Jun 17, 2026
- Chapter 185: "…I’m here to end the rot," Jun 17, 2026
- Chapter 184: "I don’t want war," Jun 17, 2026
- Chapter 183: Lucifer was still Lucifer Jun 17, 2026
- Chapter 182: The Vampire Realm Jun 17, 2026
- Chapter 181: Home Jun 17, 2026
- Chapter 180: Fight Between Two Progenitors Jun 17, 2026
- Chapter 179: "Let’s end this farce." Jun 17, 2026
- Chapter 178: Adam Brat Jun 17, 2026
- Chapter 177: I Love You Jun 17, 2026
- Chapter 176: Luna Jun 17, 2026
- Chapter 175: It is not a request Jun 17, 2026
- Chapter 174: Son of Michael Jun 17, 2026
- Chapter 173: Shattered World Jun 17, 2026
- Chapter 172: Mine Jun 17, 2026
- Chapter 171: A Promise Jun 17, 2026
- Chapter 170: Nothing Jun 17, 2026
- Chapter 169: Enough Jun 17, 2026
- Chapter 168: Fake Meeting Real Jun 17, 2026
- Chapter 167: An Echo Meeting The Original Jun 17, 2026
- Chapter 166: A Grieving Mother Jun 17, 2026
- Chapter 165: Eden’s Requiem Jun 17, 2026
- Chapter 164: The Power Of A True Angel Jun 17, 2026
- Chapter 163: Killing Vladimir Jun 17, 2026
- Chapter 162: The Death Of A Friend Jun 17, 2026
- Chapter 161: Round 2 Jun 17, 2026
- Chapter 160: The Apocalypse Is Here Jun 17, 2026
- Chapter 159: Fighting Vladimir Jun 17, 2026
- Chapter 158: Damaris Jun 17, 2026
- Chapter 157: Awakening Jun 17, 2026
- Chapter 156: "This is the end for you." Jun 17, 2026
- Chapter 155: Adam Jun 17, 2026
- Chapter 154: "Tell them to bring my boy back." Jun 17, 2026
- Chapter 153: War Of Mankind 4 Jun 17, 2026
- Chapter 152: War Of Mankind 3 Jun 17, 2026
- Chapter 151: War Of Mankind 2 Jun 17, 2026
- Chapter 150: War Of Mankind 1 Jun 17, 2026
- Chapter 149: Clone’s Encounter Jun 17, 2026
- Chapter 148: Velath’rein: The Rite of Lineage Echo Jun 17, 2026
- Chapter 147: Escape Jun 17, 2026
- Chapter 146: Malakov’s Plan Jun 17, 2026
- Chapter 145: Looking At The Crimson Grimoire Jun 17, 2026
- Chapter 144: Reclaiming Jun 17, 2026
- Chapter 143: Fighting The Ghouls 2 Jun 17, 2026
- Chapter 142: Fighting The Ghouls 1 Jun 17, 2026
- Chapter 141: Lucifer’s Suspicion Jun 17, 2026
- Chapter 140: Bloodline Guild Jun 17, 2026
- Chapter 139: it’s too much* Jun 17, 2026
- Chapter 138: I need you inside me* Jun 17, 2026
- Chapter 137: Lucifer’s Intention Jun 17, 2026
- Chapter 136: Crimson Grimoire Jun 17, 2026
- Chapter 135: I want you to live Jun 17, 2026
- Chapter 134: Kidnapped Luna Jun 17, 2026
- Chapter 133: Lucifer’s Girl Jun 17, 2026
- Chapter 132: Interview With The Devil Jun 17, 2026
- Chapter 131: Project Black Broadcast Jun 17, 2026
- Chapter 130: The Wrath Of The Origin Clan Jun 17, 2026
- Chapter 129: "Let’s burn them all." Jun 17, 2026
- Chapter 128: Fuck, Ella* Jun 17, 2026
- Chapter 127: Hey Ella* Jun 17, 2026
- Chapter 126: Then stop losing Jun 17, 2026
- Chapter 125: Purging Jun 17, 2026
- Chapter 124: Unlikely Alliance Jun 17, 2026
- Chapter 123: Cleanup Jun 17, 2026
- Chapter 122: "I am." Jun 17, 2026
- Chapter 121: Back To School Jun 17, 2026
- Chapter 120: Uproars Jun 17, 2026
- Chapter 119: Agreement Jun 17, 2026
- Chapter 118: The Summit 3 Jun 17, 2026
- Chapter 117: The Summit 2 Jun 17, 2026
- Chapter 116: The Summit 1 Jun 17, 2026
- Chapter 115: Luna Rae Jun 17, 2026
- Chapter 114: Making Decisions Jun 17, 2026
- Chapter 113: Second Evolution Jun 17, 2026
- Chapter 112: New World Jun 17, 2026
- Chapter 111: To A New Beginning Jun 17, 2026
- Chapter 110: “Don’t Call Me That.” Jun 17, 2026
- Chapter 109: The Adversaries Jun 17, 2026
- Chapter 108: Lilith Origin Jun 17, 2026
- Chapter 107: Enough Jun 17, 2026
- Chapter 106 - 2v1 3 Jun 17, 2026
- Chapter 105 - 2v1 2 Jun 17, 2026
- Chapter 104 - 2v1 1 Jun 17, 2026
- Chapter 103: For The World Jun 17, 2026
- Chapter 102: Origin Fights Back Jun 17, 2026
- Chapter 101: The Origin’s Arrive Jun 17, 2026
- Chapter 100: Remu’s Death 2 Jun 17, 2026
- Chapter 99: Remu’s Death 1 Jun 17, 2026
- Chapter 98: Dera’s Conviction Jun 17, 2026
- Chapter 97: Defeated Remu Jun 17, 2026
- Chapter 96: “No one touches them but me.” Jun 17, 2026
- Chapter 95: The Fight Of The Heads Jun 17, 2026
- Chapter 94: Teemah Is Here For Ruka Jun 17, 2026
- Chapter 93: Rematch 2 Jun 17, 2026
- Chapter 92: Rematch 1 Jun 17, 2026
- Chapter 91: The Origin Gears Up Jun 17, 2026
- Chapter 90: Rey Pledging His Loyalty Jun 17, 2026
- Chapter 89: The Tear 2 Jun 17, 2026
- Chapter 88: The Tear 1 Jun 17, 2026
- Chapter 87: Origin Jun 17, 2026
- Chapter 86: The Secrets Of The Realms Jun 17, 2026
- Chapter 85: Remu’s True Might Jun 17, 2026
- Chapter 84: Daniel’s Plans Jun 17, 2026
- Chapter 83: Prison Break 2 Jun 17, 2026
- Chapter 82: Prison Break 1 Jun 17, 2026
- Chapter 81: The First Demon Jun 17, 2026
- Chapter 80: Angered Leaders Jun 17, 2026
- Chapter 79: Beating Remu Jun 17, 2026
- Chapter 78: Reality Phantasm Jun 17, 2026
- Chapter 77: Three Tails Jun 17, 2026
- Chapter 76: The Power Of Remu Jun 17, 2026
- Chapter 75: Vina Vs Teemah Jun 17, 2026
- Chapter 74: Dark Remu Jun 17, 2026
- Chapter 73: A Stubborn Vina Jun 17, 2026
- Chapter 72: Temmy Making A Deal With Greta Jun 17, 2026
- Chapter 71: Dark Witch Jun 17, 2026
- Chapter 70: Looking For Remu Jun 17, 2026
- Chapter 69: Back Home Jun 17, 2026
- Chapter 68: Teemah Jun 17, 2026
- Chapter 67: Demon King 2 Jun 17, 2026
- Chapter 66: Demon King 1 Jun 17, 2026
- Chapter 65: The Voice 2 Jun 17, 2026
- Chapter 64: The Voice 1 Jun 17, 2026
- Chapter 63: Killing Drax Jun 17, 2026
- Chapter 62: Fighting Drax Jun 17, 2026
- Chapter 61: Lucifer’s Turn 2 Jun 17, 2026
- Chapter 60: Lucifer’s Turn 1 Jun 17, 2026
- Chapter 59: Lucifer Stepped In Jun 17, 2026
- Chapter 58: Ruka’s Fight Jun 17, 2026
- Chapter 57: Anita’s Fight Jun 17, 2026
- Chapter 56: Alessia’s Fights Jun 17, 2026
- Chapter 55: Ambush Jun 17, 2026
- Chapter 54: Targeting Lucifer Jun 17, 2026
- Chapter 53: Essence Absorption Jun 17, 2026
- Chapter 52: Deciding His Fate 2 Jun 17, 2026
- Chapter 51: Deciding His Fate 1 Jun 17, 2026
- Chapter 50: Beating Up Lucifer Jun 17, 2026
- Chapter 49: Pissed Off Lucifer 2 Jun 17, 2026
- Chapter 48: Pissed Off Lucifer 1 Jun 17, 2026
- Chapter 47: You’re dead Jun 17, 2026
- Chapter 46: Brothers Jun 17, 2026
- Chapter 45: The Truth About Ruka And Lucifer Jun 17, 2026
- Chapter 44: Sealing An Eight Legged Spider Jun 17, 2026
- Chapter 43: Fighting A Jorogumo Jun 17, 2026
- Chapter 42: Nephilim And A Cambion Jun 17, 2026
- Chapter 41: Ruka 2 Jun 17, 2026
- Chapter 40: Ruka 1 Jun 17, 2026
- Chapter 39: Waking Vampire Cores Jun 17, 2026
- Chapter 38: Meeting Of The Heads 2 Jun 17, 2026
- Chapter 37: Meeting Of The Heads 1 Jun 17, 2026
- Chapter 36: Evolution 2 Jun 17, 2026
- Chapter 35: Evolution 1 Jun 17, 2026
- Chapter 34: Vina And Rey Jun 17, 2026
- Chapter 33: First Step Jun 17, 2026
- Chapter 32: Starting A Clan Jun 17, 2026
- Chapter 31: Vina Jun 17, 2026
- Chapter 30: Monster Hunter Jun 17, 2026
- Chapter 29: Ghul Jun 17, 2026
- Chapter 28: "I Need To Level Up." Jun 17, 2026
- Chapter 27: Heavenly Oath Jun 17, 2026
- Chapter 26: A Shocking Revelation Jun 17, 2026
- Chapter 25: Getting A Daylight Ring 3 Jun 17, 2026
- Chapter 24: Getting A Daylight Ring 2 Jun 17, 2026
- Chapter 23: Spar Fight 2 Jun 17, 2026
- Chapter 22: Spar Fight 1 Jun 17, 2026
- Chapter 21: Getting A Daylight Ring 1 Jun 17, 2026
- Chapter 20: The First Childe 2 Jun 17, 2026
- Chapter 19: The First Childe 1 Jun 17, 2026
- Chapter 18: Planning Jun 17, 2026
- Chapter 17: Progenitor’s Artifacts Jun 17, 2026
- Chapter 16: Ella Is Back Jun 17, 2026
- Chapter 15: Marking Ella (R18) Jun 17, 2026
- Chapter 14: Dominating Ella 2 (R18) Jun 17, 2026
- Chapter 13: Dominating Ella (R18) Jun 17, 2026
- Chapter 12: Orientation Jun 17, 2026
- Chapter 11: Interesting Vampire Jun 17, 2026
- Chapter 10: Crescent Hill College Jun 17, 2026
- Chapter 9: Beating Up Ella Jun 17, 2026
- Chapter 8: Francisca Is Furious Jun 17, 2026
- Chapter 7: First Kill Jun 17, 2026
- Chapter 6: The Progenitor Vampire System Jun 17, 2026
- Chapter 5: The Night 2 Jun 17, 2026
- Chapter 4: The Night 1 Jun 17, 2026
- Chapter 3: Secrets Unveiing Jun 17, 2026
- Chapter 2: A Night Like No Other 1 Jun 17, 2026
- Chapter 1: The Tales Of Two Friends Jun 17, 2026
By posting a comment, you agree to all relevant terms.
There are currently no comments. Join the community and start the discussion.
Please create an account or sign in to post a comment.
User Comments
0 comments from readers